current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1zem_A mol:protein length:262 xylitol dehydrogenase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGGLast
1 -109.0001zem_A mol:protein length:262 xylitol dehydrogenase  ali model  100  1MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG 262
2 -98.3001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  37  7PTTRFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLD--------PENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGG 262
3 -97.1004ure_A mol:protein length:248 CYCLOHEXANOL DEHYDROGENASE  ali model follow..  31  1..MLLEGKTALVTGAGNGIGRTIALTYAAEGANVVVSDISDEWGRETLALIEGKGGKAVFQHADTAHPEDHDELIAAAKRAFGRLDIACNNAGISGEFTPTAETTDAQWQRVIGINLSGVFYGVRAQIRAMLETGGGAIVNISSIAGQIGIEGITPYTAAKHGVVGLTKTVAWEYGSKGIRINSVGPAFINTTLVQNV----------------PLETRRQLEQMHALRRLGETEEVANLVAWLSSDKASFVTGSYYAVDGG 244
4 -96.9004gh5_A mol:protein length:269 Short-chain dehydrogenase/reductase SDR  ali model follow..  34  9MSNRLKNEVIAITGGGAGIGLAIASAALREGAKVALIDLDQGLAERSAAMLSTGGAVAKGFGADVTKAADITAAITSAEQTIGSLTGLVNNAGIAGF-GSVHDADAAAWDRIMAVNVTGTFLASKAALAGMLERHKGTIVNFGSVAGLVGIPTMAAYCAAKGAIVNLTRQMAADYSGRGVRVNAVCPGTVTSTGMGQQLLG----------SDTSPEVQARRLAKYPIGRFGTPEDIAEAVIFLLSDQAAFVTGAAFAVDGG 259
5 -96.2005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  31  2..KRLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAARSEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNKNLTAGDTDEFFRILKDNVQSVYLPAKAAIPHMEKVGGGSIVNISTIGSVVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAALENM---------------TDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGG 248
6 -95.9004fn4_A mol:protein length:254 Short chain dehydrogenase  ali model follow..  29  3..QSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGMGKEVLGVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFYSSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRAVAVLPGTVKTNIGLGSS------------KPSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFVNGDAVVVDGG 250
7 -95.9002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  33  2......SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTWHAYADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNSGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRL--------------DQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGA 246
8 -95.3004ni5_A mol:protein length:254 Oxidoreductase, short-chain dehydrogenase/red  ali model follow..  32  1MAMRFKDKVVIVTGGASGIGEATARAFIREGAKVVIADFS-DHGQQLADERAGAHEQALFIKTDVADTRAVQALIARTVENYGRLDIMFANAGIAAD-APIDELDEAAWQKTIDINLTGVYLCDKYAIDQMRSQGGGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGYIDTPLLKNI----------------PDDKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNGASLLVDGG 244
9 -94.9003tox_A mol:protein length:280 Short chain dehydrogenase  ali model follow..  29  2VMSRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTARNGNALAELTDEIAGGGGEAAALAGDVGDEALHEALVELAVRRFGGLDTAFNNAGALGAMGEISSLSVEGWRETLDTNLTSAFLAAKYQVPAIAALGGGSLTFTSSFVGTAGFAGVAPYAASKAGLIGLVQALAVELGARGIRVNALLPGGTDTPANFAN------------LPGAAPETRGFVEGLHALKRIARPEEIAEAALYLASDGASFVTGAALLADGG 252
10 -94.8004qec_A mol:protein length:248 ElxO  ali model follow..  27  2......KKNVLITGGFKGIGKQVALEFLKNDYHVCITSRYFEKEKRIPHLFSSYEENISFYQLDVTDEEQVNEIINKIVKKFGRLDVLVNNAGISLSDGLLTETKTTDFNKMINTNILGTYFCMKYALKHMQKVSCGAIVNISSITGLSGFPYSILYGSTKHAVIGLTKGAAVEFADKGIKINAVAPGIIKTETLQKEI-------------DSGEFSEDSISSIHPMQKLGTTLDVAKGIYFLANEDNNFITGHVLSIDGG 244
11 -94.3004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  33  15QSMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEI---GSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTT-GNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFAE----------AKDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGG 262
12 -94.2003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  32  8..FHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPK--PFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVL---------------TPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGG 250
13 -93.6004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  33  1..MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCDVQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKD-ARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMTEQGKGVILNASSVVGLYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTV----------------PDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGG 243
14 -93.5003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  28  4.SMSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEI---GDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGHKPQNAELVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGAKGILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLT------------TFMGEDSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGG 253
15 -93.4001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  32  7..LRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPK--PFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVI---------------TPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGG 249
16 -93.3005f1p_A mol:protein length:265 PtmO8  ali model follow..  31  6...RLEGKIAIVTGAASGIGAVTAERLAAEGARVALADLDAVGVQTLAEKIRGAGTHAIGIEVDLADPASVRAMVAAAVEEFGGLDILHNNAAATALAVPVADADPEVWDRTMRVNLSGAMVATQAALPHLIARGGGCVINTSSAAGLSGDLSHPAYAASKAALISLTRSVATQAGRSGVRCNAIAPGLIITRPE-------------------REAAYRVMLPHHLTTRLGRPEDVASAVVFLASDEASFITGQTLVVDGG 250
17 -92.8002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  34  3...LFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVA------EAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAP-GSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIAL----------SPDPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGG 244
18 -92.7003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  27  5MQLSFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGRNPDKLAGAVQELEALGGAIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGGSENIGPITQVDSEAWRRTVDLNVNGTMYVLKHAAREMVRGGGGSFVGISSIAASNTHRWFGAYGVTKSAVDHLMQLAADELGASWVRVNSIRPGLIRTDLVAAIT--------------ESAELSSDYAMCTPLPRQGEVEDVANMAMFLLSDAASFVTGQVINVDGG 255
19 -92.6004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  28  9RPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYE-----EPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGTGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGSARIITIGSVNSFMAEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGY--------------SEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGG 257
20 -92.6003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  25  5MGGLLTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVTDTGRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFRVPSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPAL-EESKGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYFEHQAGKYGT-----SVEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCG 260
21 -92.3004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  1..MSTDKRVAIITGAANGIGRATALEFAQAGYHVVAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGEVVKKMAEAQFDAVISVNLKGVFLCTQAVAPHMIAAKYGRILNASSVVGLYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQM----------------PERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGG 252
22 -91.7003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  26  18..MNQPSPVALITGAGSGIGRATALALAADGVTVGALGRTRTEVEEVADEIVGAGGQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGINGVWAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRGGGAIVVVSSINGTFTTPGATAYTATKAAQVAIVQQLALELGKHHIRVNAVCPGAIETNISDNTKLRHEEETAIPV-------EWPKGQVPITDGQPGRSEDVAELIRFLVSERARHVTGSPVWIDGG 272
23 -91.2003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  33  4.SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADINAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIFGGMDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMTKRGGGAIVNQSSTAAWLY---SNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANRTTT---------------PKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGG 248
24 -91.1001yde_A mol:protein length:270 Retinal dehydrogenase/reductase 3  ali model follow..  28  3TGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQEL----PGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYL-RKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAAL----------MPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASE-ANFCTGIELLVTGG 248
25 -90.6003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  28  8..FDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGL---ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTM-RPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNKGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREIIW-----EAELRGMTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGG 259
26 -90.5004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  31  2MMKRLEGKSALITGSARGIGRAFAEAYVREGATVAIADIDIERARQAAAEI---GPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDL-APIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGGGKIINMASQAGRRGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDALF-----ARYENRPRGEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGG 255
27 -90.5001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  30  1..MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI---GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDL-APIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKF-----ADYENLPRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGG 252
28 -90.3004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  27  3MGGQLKGKIAVITGSTQGLGAATARLFAERGAQGLVIGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDR-GTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDREGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIQRE---------YHGAPANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQS 256
29 -90.2005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  34  3..ELLKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDIDGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVAGRAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPAL-KAAKGNVVHLCSVAGFVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQL--------------NRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGG 247
30 -90.2002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  30  11...PLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRGGGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMD--------------KARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGG 255
31 -90.2005HS6 Entity 1(prereleased)  ali follow..  28  5TGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQEL----PGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYL-RKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAAL----------MPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASE-ANFCTGIELLVTGG 250
32 -90.1003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  34  20...DLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKI---GCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHL-ASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMF---------DGALGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGG 265
33 -90.0004weo_A mol:protein length:266 Putative acetoin(Diacetyl) reductase  ali model follow..  31  3MTAPLEGQVAIVTGGARGIGRGIALTLAGAGANILLADLLDDALDATAREVRALGRRAAIAKVDVTQAAQVDAMVAQALADLGGLDILVNCAGVISI-HPVAELTERDWDFVMNVNAKGTFLGCRAALAHLKAQGRGRIINVASIAGKEGFPNLAHYSASKFAVVGFTNALAKELARDGVTVNAICPGIVRTYMWDRLSDEWKTDGESV-----EQSWQRHQLTLIPQGRAQTPEDMGRLALFFATMD--NVTGQAVNVDGG 256
34 -89.9004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  27  15..NLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSN-NVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGN----------------PPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGA 259
35 -89.9003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  31  12...PLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMD--------------KEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGG 256
36 -89.7004gkb_A mol:protein length:258 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  27  1MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPD-GAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVND--GIGLDAGRDAFVASLERNLIHYYAMAHYCVPHL-KATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATF----------EDPEAKLAEIAAKVPLGRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGG 249
37 -89.7005jc8_A mol:protein length:276 Putative short-chain dehydrogenase/reductase  ali model follow..  29  6.AGRLQGKVALVTGAGCGNGRAIAVRFAEEGAHVIAVDRDLASMDATLELVRAAGGSVTPCLCDVTDSASVERLVADSVARCGRVDILVNNVGAPSP-GGPVALDEAQWAMQLELNLTTAFLMCKYVLPVMEQQGGGAIVNIASTSGIRWGAAQVGYAAAKAGMIQMGRVVAVEYAAKNVRVNSVVPGLLHTPMVDTKIAHNQA-------GGDVELLLRKRQARIPMPFMGDGRDTANAALFLASDEARFVTGTEIVVDGG 264
38 -89.6003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  28  18..QGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAG-----------IAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISR-GRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFAKR---------GFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGG 256
39 -89.4003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  31  8.KLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDEAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICISEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQKQGVIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGM--------------EKPELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAG 256
40 -89.3004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  34  1MMSRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRD-SMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEV----------------PEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGG 241
41 -89.2003wtc_A mol:protein length:262 Putative oxidoreductase  ali model follow..  29  3.HMSLSGKIAAVTGAAQGIGKAIALRLAKDGADVILLDVKQDTLAETAKEVEALGRRAVALTADISNRDQFRSTLADAAKTLGGLDIMVNNAGICQV-KPILDIEPAEIEKIFSINVQGVLWGMQAAATLFKEKGKGKIINACSIAGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDMWVTIDKRM-----AEITGTEIGATYKKYVEGIALGRVETADDVAGFVAYLSSSDADYMTGQSVLIDGG 258
42 -89.1004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  28  5LQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQD-EFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV----------------PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG 258
43 -88.9001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  31  2......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPS-TPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKP-----LGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGG 252
44 -88.8002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  28  1MQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQD-EFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV----------------PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG 254
45 -88.7003tzq_B mol:protein length:271 Short-chain type dehydrogenase/reductase  ali model follow..  30  5MTAELENKVAIITGACGGIGLETSRVLARAGARVVLADLPETDLAGAAASV---GRGAVHHVVDLTNEVSVRALIDFTIDTFGRLDIVDNNAAHSDPAMLVTQMTVDVWDDTFTVNARGTMLMCKYAIPRLISAGGGAIVNISSATAHAAYDMSTAYACTKAAIETLTRYVATQYGRHGVRCNAIAPGLVRTPRLEVGL---------------PQPIVDIFATHHLAGRIGEPHEIAELVCFLASDRAAFITGQVIAADSG 249
46 -88.5003wye_A mol:protein length:256 Diacetyl reductase [(S)-acetoin forming], L-2  ali model follow..  33  2......KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGIAQI-KPLLEVTEEDLKQIYSVNVFSVFFGIQAAVEAFKKEGGGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQTAARDLAPLGITVNGYCPGIVGTGMWEQIDAELSKINGKP-----IGENFKEYSSSIALGRPSVPEDVAGLVSFLASPDSDYMTGQSLLIDGG 252
47 -88.4004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  30  15LRPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMVEARRGWIVNTSSVAGKTYSPVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGV----------------APEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGG 263
48 -88.2002zk7_A mol:protein length:257 Glucose 1-dehydrogenase related protein  ali model follow..  29  3MFSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPG-----------EAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESY-GKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAP-LLRCNAVCPATIDTPLVRKAAELEVGS------PMRIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGG 246
49 -88.0002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  35  2....LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYANEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKD-NLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVL----------------DENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGG 243
50 -87.8003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  27  6..FDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPD-APLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLEN----------------GEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGG 250
51 -87.7002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  31  1..MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRD-TLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVL----------------PDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGG 244
52 -87.7003zn2_A mol:protein length:254 HALOHYDRIN DEHALOGENASE  ali model follow..  22  2.......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDEL------EAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSAAPFGPWKELSTYTSARAGASTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWK--------TNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGG 242
53 -87.5001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  29  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENP-VSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFAD--------------PEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGG 249
54 -87.5003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  24  2KPYDLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQRGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRV-STFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRADAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREERELD-----AQWTAQLARNKQIPLGRLGKPIEAARAILFLASPLSAYTTGSHIDVSGG 260
55 -87.4001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  22  2.......STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDEL------EAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWK--------TNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGG 242
56 -87.4001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  30  1MYKDLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANP-VSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFAD--------------PEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGG 249
57 -87.3004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  26  1MFPDLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAATSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADK----------------TQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGG 254
58 -87.3003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  24  2....EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYASKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVL-RPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHF--------------PNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGG 245
59 -87.3003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  26  1MFPDLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAAAATSAVISTGSIAGHTGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADK----------------TQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHLASYITGQVLDINGG 254
60 -87.2003sju_A mol:protein length:279 Keto reductase  ali model follow..  31  13.SHMSRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAAGHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGG-GETADLDDALWADVLDTNLTGVFRVTREVLRAMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVREGYARHWGV-----TEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGG 269
61 -87.2004e4y_A mol:protein length:244 Short chain dehydrogenase family protein  ali model follow..  28  1...SNAMANYLVTGGSKGIGKAVVELLLQNKNHTVINIDIQQ---------SFSAENLKFIKADLTKQQDITNVLDII--KNVSFDGIFLNAGILIK-GSIFDIDIESIKKVLDLNVWSSIYFIKGLENNL--KVGASIVFNGSDQCFIAKPNSFAYTLSKGAIAQMTKSLALDLAKYQIRVNTVCPGTVDTDLYRNLIQKYANNVGI-----SFDEAQKQEEKEFPLNRIAQPQEIAELVIFLLSDKSKFMTGGLIPIDGG 240
62 -87.1003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  30  20....LKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQ-TPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTS---------------SSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQ 264
63 -87.1001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  32  16..ATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREAGVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGG-GATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHY-----SDIWEVSTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG 271
64 -87.1003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  32  2....SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYASKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL----------------SDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGG 243
65 -87.0005jla_A mol:protein length:274 Putative short-chain dehydrogenase/reductase  ali model follow..  31  6.SAEFNGAIAVVTGAGSGIGRACAELLSRSGANVIVADRDIEAATRVARAT-----GGKTLVLDVGEDASVTAAANEVRARYGVADVLVNCAGVLQRTLPPGELAQREWDVVSRIDLRGTYLCCAAFGAPMADRRRGSIVNIASVAGMRSGPLHA-YGPAKAGVISLTETLAGEWGPKGVRVNCVSPGFTQTPALERGF-------------TTHTLKADVLRDAAALGHIVSANEIAEAVVFLASERASAITGVNLPVDAG 247
66 -86.9003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  31  3MYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENP-VPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFAD--------------PVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGG 251
67 -86.7003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  27  1MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGYVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEAT----------------IQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGA 250
68 -86.7004jro_A mol:protein length:271 FabG protein  ali model follow..  35  19..MTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRD-NLLMRMKEDEWDDVININLKGTFLCTKAVSRTMMKQRAGKIINMASVVGLIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKL----------------DEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGG 262
69 -86.6003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  29  2......SKVAMVTGGAQGIGRGISEKLAADGFDIAVADLQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQI-KPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAELSKINGKP-----IGENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGG 254
70 -86.5003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  34  23...DLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSV-QAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGGGTIITTASMSGHIINIPVSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPL-----------------ADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGG 266
71 -86.4002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  30  1MTQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVP--APEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPL-IPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMLQ--------------AIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGG 245
72 -86.4004wec_A mol:protein length:278 Short chain dehydrogenase  ali model follow..  30  18LTQRLAGKVAVITGGASGIGLATGRRLRAEGATVVVGDIDPTTGKAAADEL-----EGLFVPVDVSEQEAVDNLFDTAASTFGRVDIAFNNAGISPPEDDIENTDLPAWQRVQDINLKSVYLSCRAALRHMVPAGKGSIINTASFVAVMGSASQISYTASKGGVLAMSRELGVQYARQGIRVNALCPGPVNTPLLQELF-------------AKDPERAARRLVHIPLGRFAEPEELAAAVAFLASDDASFITGSTFLVDGG 263
73 -86.3004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  33  2..KKLEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGD---------LTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKD-AMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQTNGYGSIINISSVVGVFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTV----------------PQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGG 237
74 -86.3001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  33  1..MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAV-----GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRD-NFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKV----------------PEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGG 237
75 -86.1003vtz_A mol:protein length:269 Glucose 1-dehydrogenase  ali model follow..  32  5...EFTDKVAIVTGGSSGIGLAVVDALVRYGAKVVSVSLDEKSDVNV----------SDHFKIDVTNEEEVKEAVEKTTKKYGRIDILVNNAGIEQY-SPLHLTPTEIWRRIIDVNVNGSYLMAKYTIPVMLAIGHGSIINIASVQSYAATKNAAAYVTSKHALLGLTRSVAIDYAP-KIRCNAVCPGTIMTPMVIKAAKMEVGE------ENAVERKIEEWGRQHPMGRIGRPEEVAEVVAFLASDRSSFITGACLTVDGG 246

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.