current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1yo8_A mol:protein length:634 thrombospondin-2, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .
# Score Template Links and tools%idFirst ADPDGCLSNPCFPGAQCSSFPDGSWSCGFCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDIAAGLast
1 -178.0001yo8_A mol:protein length:634 thrombospondin-2  ali model  100  1ADPDGCLSNPCFPGAQCSSFPDGSWSCGFCPVGFLGNGTHCEDLDECALVPDICFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDDDNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDIAAG 628
2 -78.8003fby_A mol:protein length:551 Cartilage oligomeric matrix protein  ali model follow..  53  1...........................RSPWPGVPTSPVWNSAQRFCP--DGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRD----------TDLDGFPDEKLRCPERQCRKDNCVTVPNS---------------------------------------------------GQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPE 539
3 -62.7001ux6_A mol:protein length:350 THROMBOSPONDIN-1  ali model follow..  80  3...........................................................................................................................................................................................................................................................................................LVALADNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNSDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVKSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP... 344
4 -34.0004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  15  202.TEPICLPGCDEQHGFCDK----PGEC-KCRVGWQGRYC-----DECIRY-----PGCLHGTCQQ---PWQC-NCQEGWGGLFCN--------------QDLNYCTHH-KPCKNGATCTNT---GQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGYSCRCPVGYSGFNCEKKIDYCSSS-----PCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASSP------------CANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHQRGHGYVCECARSYGGPNCQFLLP------ELPPGPAVVDLTEKLEGQGGPFPWENLYFQ.............................................................................................................................................................................................................................................. 531
5 -20.6005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  25  2AQADPCASNPCANGGQCLPFE-ASYIC-HCPPSFHGPTCR-QDVNECGQKPG---LCRHGGTCHNEVGSYRC-VCRATHTGPNCE--------------RPYVPCSPS--PCQNGGTCRPT---GDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTE.............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 157
6 -19.8002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  24  1.DSRGC-ARWCPQDSSCVN----ATAC-RCNPGFSSPMETCDDINECATLSKV--SCGKFSDCWNTEGSYDC-VCSPGYEPVS---GAKTFKNESENTCQDVDECSSGQHQCDSSTVCFN----TVGSYSCRCRPGWKPRH....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 131
7 -19.5005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  24  2...DPCASNPCANGGQCLPFE-ASYIC-HCPPSFHGPTCR-QDVNECGEKPG---LCRHGGTCHNEVGSYRC-VCRATHTGPNCE--------------RPYVPCS--PSPCQNGGTCRPT---GDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTE.............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 154
8 -18.0001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  14  40KDGDQCETSPCQNQGKCKDGL-GEYTC-TCLEGFEGKNCE-LFTRKL----CSLDNGDCDQFCHEEQNSVVC-SCARGYTLADNGKACIPTGPY----------------PCGKQTLERR----KRSVAQATSSSGEAPSITWKPYDAADLDPTENPFDLLDFNQTQPERGDNNLTRIVGGQE............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 195
9 -17.3002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  25  3QDVDECSANPCEHAGKCINTL-GSFEC-QCLQGYTGPRCE-IDVNECVSN-----PCQNDATCLDQIGEFQC-ICMPGYEGVHCE--------------VNTDECA--SSPCLHNGRCL----DKINEFQCECPTGFTGHLCQVDLHHILDAQKMVWN...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 133
10 -17.1004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  2............AAYLVQNQW-GGSQA-TWNPGGLW-GARDQNVVALDI------KSDDGGKTLKGTMTYNG-EGPIGFRGTLSSANNYTVENQPGGVWVLGARDKQNIVAVSIKSNDGGKTLTGTTTYNGEGPIGFKSEVTDGDTYSVENQWGGSAAPWHSG--------------------------GVWVLGTRGKQNVINVDAKS--------------------------NDGGKTLSGTMTYNGEGPIGFRGTLTSPDTYTVENQWGGSTAPWNPGG-----------------FWMIGARNGQNVVALNVA----SSDGGKTLAGTMIYNGEGPIGFRAR......................................................................................................................................................................................................................................................................................... 265
11 -16.9001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  15  2AEASAVTVDTICKNGQLVQMS-NHFKC-MCNEGLVLSENTCEEKNECKKETLGK-ACGEFGQCIEQVNMYKC-GCIEGYTLKE--------------DTCVLDVCQYK--NCGESGECIVEYLSEIQSAGCSCAIGKVPNPEDEKKCTKTGETNTDNEVCKNVEGVYKCQCMEGF..................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 168
12 -16.9004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  5....TKTSKGFNNLQHVQNQWGGS--SAPWHEGGMWVLGCRSGQNVVALNI----KSGDGGRTLTGTMTYVG-EGPIGFRATLTQSNTYAVENQPGGTWVIGCRVNQQVVALDIESGDQGATLAGTMTYAGEGPIGFKSQQADGGVYAVENQWGGSSAPWHNG-------------------------------------------GVWVIGARDQAVVAVS----------IGSTDSGKTLNGNMTYAGEGPIGFKGNSVAGNNYAVENQWGGTSAPWHPGGIWLLGCRS---------------------GQNVVELYITSGDNGNTFHGSMTYSGEGPIGFRAMALPQ..................................................................................................................................................................................................................................................................................... 279
13 -16.8001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  17  1TDVNECLDPTTCISGNCVNTP-GSYIC-DCPPDFEPTRVGCVDTRSGN--------CYLDIRPRGDNGDTAC-SNEIGVGVSKCPGGEGFRPNPITVILEDIDECQELPGLC-----QGGKCINTFGSFQCRCPTGYY.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 153
14 -16.7004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  25  1.DVDECAANPCEHAGKCLNTL-GSFEC-QCLQGYTGPRCE-IDVNECISN-----PCQNDATCLDQIGEFQC-ICMPGYEGVYCE--------------INTDECAS--SPCLHNGRCV----DKINEFLCQCPKGFSGHLCQSGRLEVLFQ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 124
15 -16.6004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  24  1...DICDPNPCENGGICLPLADGSFSC-ECPDGFTDPNCS-SVVEVASAGPCTPNPCHNGGTCEDTFIGYVC-KCPRGFNGIHCQ--------------HNINECEV--EPCKNGGICT----DLVANYSCECPGEFMGRNCQYKGG................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 136
16 -15.7002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  21  2ADIDECESSPCING-VCKNSP-GSFIC-ECSSESTPTKTICIETIKG--------------TCWQTVIDGRCPICGKGYS------------RIKGTQCEDIDECEVFPGVCKN-----GLCVNTRGSFKCQCPSGMT.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 138
17 -15.1004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  21  199.NRAICRQGCSPKHGSCKL----PGDC-RCQYGWQGL--YC---DKCI-----PHPGCVHGICNE---PWQC-LCETNWGGQLCD--------------KDLNYCGTH-QPCLNGGTCSN---TGPDKYQCSCPEGYSGPNCE..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 303
18 -15.1004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  23  196...PECNHTACMNNGVC-HEDTG--EC-ICPPGFMGRTCECEL-RTCKERCSGQEGCKSYVFCLPDPYG--C-SCATGWKGLQCN-----------EACHPGPDCKLRCS-CNNGEMCDRFQG-------CLCSPGWQGLQCE..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 319
19 -15.0001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  15  10..VRGNLERECIEEKCSFEEAREVF--ENTEKTNEFWKQY-VDGDQCEPN-----PCLNGGLCKDDINSYEC-WCQVGFEGKN---------------------CELDATCNIKNGRCKQCKTGADSKVLCSCTTGYRLAPDQKSCKPAVPFPCGRVSVSHSPTTLTR............................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 146
20 -14.0001fax_L mol:protein length:96 FACTOR XA  ali model follow..  21  2KDGDQCETSPCQNQGKCKDGL-GEYTC-TCLEGFEGKNCELFTRKLCSLD-----NGDCDQFCHEEQASVVC-SCARGYTLADNGKACIPTGPYPCGK.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 91
21 -13.4001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  12  3LAQQTCANNQCSVHAECRDY-ATGFCC-RCVANYTGNGRQCVAEGSPQRVNGK-VKGRIFVGSSQVPVVFEN-TDLHSYVVMN-----------HGRSYTAISTIPETVGYSLLPLAPIG----GIIGWMFAVEQDGFKNGFSIT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 130
22 -13.2003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  22  3.PVDPCFRANCEY--QCQPLNQTSYLC-VCAEGFAHEPHRCQLFCNQTACPADC----------DPNTQASC-ECPEGYI-------------DDGFICTDIDE-------CENGGFCSGVCHNLPGTFECICGPDSA.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
23 -13.2001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  19  45SDGDQCASSPCQNGGSCKDQL-QSYIC-FCLPAFEGRNCE-THKDDQLICVNENGGCEQ--YCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEY----------------PCGKIPILEK--------RNASKPQG............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 151
24 -12.9001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  22  3.PVDPCFRANCEY--QCQPLDQTSYLC-VCAEGFAHEPHRCQMFCNQTACPADC----------DPNTQASC-ECPEGYI-------------DDGFICTDIDE-------CENGGFCSGVCHNLPGTFECICGPDSA.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 109
25 -12.6002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  16  3SSEHTCIDTNVPDNAACYRYLDGTEEW-RCLLTFKEEGGKCVPASTCKDNNGG---CAPEAECKMTDSNKIVCKCTKEGSE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 81
26 -12.6001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  21  45KDGDQCETSPCQNQGKCKDGL-GEYTC-TCLEGFEGKNCELFTRKLCSLD-----NGDCDQFCHEEQNSVVC-SCARGYTLADNGKACIPTGPYPCGK.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 134
27 -12.6001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  19  12LPLEHPCASLCCGHGTCIDGI-GSFSC-DCRSGWEGRFCQEVSFLNCSLD-----NGGCTHYCLEEVGWRRC-SCAPGYKLGDDLLQCHPAVKFP---CGRPWKRMEKKRS..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 112
28 -12.5004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  21  157...DSCSRDDHFGHYECQP----DGSP-SCLPGWTG--------KYCDQPICLSGCHEQNGYCSK---PDEC-NCRPGWQGPLCN------------ECIPHKGCRHGT--C-------------TIPWQCACDEGWGGLFCDQAAA................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 261
29 -12.5001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  31  3VDMDECKEPDVCKHGQCINTD-GSYRC-ECPFGYILAGNECVDTDECSVGNPCG-----NGTCKNVIGGFEC-TCEEGFE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 74
30 -12.4001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  12  2SSEHRCIDTNVPENAACYRYLDGTEEW-RCLLYFKEDAGKCVPAPNMTCKDKN-GGCAPEAECKMNDKNEIVCKCTKEGSE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 80
31 -12.3001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  16  8SSAHKCIDTNVPENAACYRYLDGTEEW-RCLLGFKEVGGKCVPASTCEENNGG---CAPEAECTMDDKKEVECKCTKEGSE-----------LFEGVFCSSSSG............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 98
32 -12.0002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  16  26...KFCRPRDDFFGHYACD---QNGNK-TCMEGWMG--------PECNRAICRQGCSPKHGSCKL---PGDC-RCQYGWQGLYCD-KCIPHPGCVHGICNEPWQCLGTHQPCLNGGTCSNT---GPDKYQCSCPEGYSGPNCE..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 162
33 -11.9002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  13  86PTVNVPLLGTVPHKASVVQ-----VGF-PCLGKQDGVAAFEVDVIVMNQQAECPGGCRNGGFCNE---RRIC-ECPDGFHGPHCEKALCT-------------------PRCMNGGLCVT-------PGFCICPPGFYGVNCDKAN---CSTTCFNGGTCFYPGK------------------------------------------------------------------------------------CICPPGLEGEQC--EISKCPQP-------------CRNGGKCI---GKSKCKCSKGYQGDLCSKPVC---EPGCGAHGTCH---EPNKCQCQEGWHGRHCNKRY................................................................................................................................................................................................................................................................................... 310
34 -11.8001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  35  1TDIDECRISPCGRG-QCVNTP-GDFEC-KCDEGYEMMMKNCMDIDECQRDPLLC----RGGVCHNTEGSYRC-ECPPGHQ.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 77
35 -11.6001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  13  1.NISQHQKKQCPQNSGCFRHLDEREEC-KCLLNYKQEGDKCVENPNCNENNG---GCDADAKCTEEGKKITC-ECTKPDSYP----------LFDGIFCSSSN............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 96
36 -11.5001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  13  1.NISQHQKKQCPQNSGCFRHLDEREEC-KCLLNYKQEGDKCVENPNCNENNGG---CDADAKCTEEGKKITC-ECTKPDSYP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 85
37 -10.7002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  16  4.PKHVCVDRDIPKNAGCFRDDDGTKEW-RCLLGYKGNTCVENNNPTCDINNGG---CDPTASCQNAESTIIC-TCKEPTPNAYYEG----------VFCSSSS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 99
38 -10.5004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  12  4KCFEPQLLRFFHKNEIWYRTEQAAV--ARCQCKGPDAHCQRLASQACRTN-----PCLHGGRCLEVEGHRLC-HCPVGYTGPFCD............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 80
39 -10.4004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  16  129...KNWKSDEQNNTLTRLRY---SYRV-VCSDNYYG--------DSCSRLCKKRDDHFGHYECQP---DGSP-SCLPGWTGKYC----------------DQPICLSG--CHEQNGYCSK-------PDECNCRPGWQGPLCN..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 227
40 -10.1003m0c_C mol:protein length:791 Low-density lipoprotein receptor  ali model follow..  12  4....KLRWTVLLLAARCER---NEFQCGKC----ISYKWVCDGSAECQDGSDESQETCLSVTC--KSGDFSC--------------------GGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDG---------KCISRQFVCDSDRDCLDGSDEASCPVLTCGPASQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPD-----CKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNCHSGECITLDKVCNMARDCRDWSDTNECLDNNGGCSHVCNDLKIGYECLCPDGFQ-----------------------LVAQRRCEDIDECQDPDTCSQLCVNLEGGYKC-------QCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDSNIYWTDSVLGTVSVADTK----GVKRKTLFRENG---SKPRAIVVDPVHGFMYWTDWGTIKKGGLNGVD-GILDLLSGRLYWVDSKLHSISSI.. 585
41 -9.8702mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  16  4.PKHVCVDRDIPKNAGCFRDDDGTEEW-RCLLGYKGNTCVENNNPTCDINNGG---CDPTASCQNASKKIIC-TCKEPTPNA----------YYEGVFCSSSS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 99
42 -9.5502w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  20  5......................SDYDI-PTTENL--YFQGAMGTNECLDNNGGC-----SHVCNDLKIGYEC-LCPDGFQ-------------VAQRRCEDIDE-------CQDPDTCSQLCVNLEGGYKCQCEEGFQ.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 92
43 -9.4901z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  29  2.DVDECSLKPCGTA-VCKNIP-GDFEC-ECPEGYRLKSKSCEDIDECSENMC-------AQLCVNYPGGYTCCDGKKGFK-----------LAQDQKSCEVVS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 87
44 -9.2301tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  15  16.QQHQSWLRPVLRSNRV-------EYC-WCNSGRAQ--CHSVPVKSCSEP-----RCFNGGTCQQALSDFVC-QCPEGFAGKSCEIDTRAT......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 91

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.