current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst GSHMRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLast
1 -38.9001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model  100  1GSHMRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLS 79
2 -31.6005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  20  7...........IPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFF 74
3 -26.8001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  31  1................................VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHAD 47
4 -26.7001iox_A mol:protein length:50 Betacellulin  ali model follow..  36  2.................................KGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVD 47
5 -25.9002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  44  2.............................SSGSSGKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEK. 50
6 -24.9001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  31  1................................VVSHFNDCPLSHDGYCLHGVCMYIEALDKYACNCVVGYIGERCQYRD 48
7 -24.3001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  33  1..................................NSDSECPLSHDGYCLHGVCMYIEALDKYACNCVVGYIGERCQYRD 46
8 -21.0003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  39  2.................................TSHLVKCAEKEKTFCVNGECFMVKDLSNPSCKCPNEFTGDRCQNYV 51
9 -19.9001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  28  1..................................NSYPGCPSSYDGYCLNGVCMHIESLDSYTCNCVIGYSGDRCEHAD 46
10 -19.7001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  26  2......................................GAPSSYDGYCLNGVAMHIESLDSYTCNCVIGYSGDRCQTRD 43
11 -19.1001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  28  1..................................NSYPGCPSSYDGYCLNGVCMHIESLDSYTCNCVIGYSGDRCQTRD 46
12 -17.1001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  41  2.................................TSHLVKCAEKEKTFCVNGECFMVKDLSNPLCKCQPGFTGARCTENV 51
13 -15.6003ltf_D mol:protein length:58 Protein spitz  ali model follow..  29  3...................................PTYKCPETFAWYCLNAHCFAVKDLPVYSCECAIGFMGQRCEYKE 50
14 -14.3003cfw_A mol:protein length:164 L-selectin  ali model follow..  23  80..........EPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALC-HGEC--VEIINNYTCNCDVGYYGPQCQFV. 156
15 -12.6002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  35  155...............................................CRNGFC-----NERRICECPDGFHGPHCEGTK 182
16 -12.1003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  16  149GFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQED----CSNGVC--LQQWDGFSCDCSTSFSGPLCND.. 222
17 -11.7001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  24  49.....................................KSCSEP----CFNGTCQQALYFSDFVCQCPEGFAGKSCE... 85
18 -11.4004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  27  40.......................................CQRLASQACRTNPCLHLEVEGHRLCHCPVGYTGPFCD... 80
19 -11.3004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  29  184.......................................CLPGWTGYC-NGYC-----SKPDECNCRPGWQGPLCN... 227
20 -11.2004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  27  216.......................................CRPGWQG-CRHGTC-----TIPWQCACDEGWGGLFCD... 257
21 -11.1004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  22  253.......................................CETNWGG-CLNGGTCSNTGPDKYQCSCPEGYSGPNCEIVD 306
22 -11.0005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  38  288.......................................CGGPGRGLCFCGK-----------CRCHPGFEGSACQ... 313
23 -10.8001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  34  43.....................................DQCETS----CQNGKCK--DGLGEYTCTCLEGFEGKNCE... 77
24 -10.5001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  31  49.....................................DQCEPN----CLNGLCK--DDINSYECWCQVGFEGKNCE... 83
25 -10.4001g1q_A mol:protein length:162 P-SELECTIN  ali model follow..  19  80..........EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQ-LETIGNYTCSCYPGFYGPECEY.. 155
26 -10.1001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  25  7.....................................DQCLVLPLEHPCASLCC-IDGIGSFSCDCRSGWEGRFCQR.. 50
27 -9.6904d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  27  1.....................................DICDPN----CENGICLPGLADGSFSCECPDGFTDPNCS... 37
28 -9.6801whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  31  48.....................................DQCEGH----CLNGHCK--DGIGDYTCTCAEGFEGKNCE... 82
29 -9.6801dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  34  48.....................................DQCASS----CQNGSCK--DQLQSYICFCLPAFEGRNCE... 82
30 -9.6002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  27  134...............................................CLNGGTCSNTGPDKYQCSCPEGYSGPNCE... 162
31 -9.6003soq_A mol:protein length:318 Low-density lipoprotein receptor-related prot  ali model follow..  14  239........GEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGID-NGGCSH--CLMSPVKPFYQCACPTGVKGKTCKDGN 311
32 -9.4701fax_L mol:protein length:96 FACTOR XA  ali model follow..  34  5.....................................DQCETS----CQNGKCK--DGLGEYTCTCLEGFEGKNCE... 39
33 -9.4505e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  24  185......................................ECRSRDRSLC-KGFLE--------ICRCDTGYIGKNCE... 221
34 -9.2903s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  10  533.DKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPC-NGGCSHIKGDGTTRCSCPMHLVELSC.... 615
35 -9.0404a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  21  580.....................................HPCAQD------NGGCSHIKGDGTTRCSCPMHLVELSCGGTK 622

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 1 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.