current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1whe_A mol:protein length:86 COAGULATION FACTOR X, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst ANSFLEEVKQGNLERECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTRLast
1 -49.7001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model  100  1ANSFLEEVKQGNLERECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTR 86
2 -35.1001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  58  1ANAFLEELRPGSLERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKD 86
3 -33.8001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  76  1ANSFLEEMKKGHLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTR 86
4 -33.4001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  63  3.SGKLEEFVRGNLERECIEEKCSFEEAREVFENTEKTNEFWKQYVDGDQCEPNPCLNGGLCKDDINSYECWCQVGFEGKNCELDAT 87
5 -32.0001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  75  1.....EEMKKGHLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTR 81
6 -30.9004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  27  22LGSFECQCLQGYTGNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQSGRL 119
7 -29.5002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  27  25LGSFECQCLQGYTGNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLH 122
8 -27.3004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  23  21.GSFSCECPDGFTDNPCHNGGTCEDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKGG 136
9 -26.9004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  19  404GDAYLCRCQAGFSGSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHQRGHGYVCECARSYGGPNCQFLLP 501
10 -26.6004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  19  3.....EKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTA 84
11 -26.1005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  20  22EASYICHCPPSFHGPLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDTHECACLPGFTGQNCEENID 122
12 -26.1004bxs_A mol:protein length:423 FACTOR X-LIKE PROTEASE  ali model follow..  65  1ANSLVEEFKSGNIERECIEERCSKEEAREVFEDDEKTETFWNVYVDGDQCSSNPCHYRGICKDGIGSYTCTCLSGYEGKNCERVLY 86
13 -25.8001fax_L mol:protein length:96 FACTOR XA  ali model follow..  12  9.............TSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKCSLDNGDCDQFCHEEQASVVCSCARGYTLADNGKACI 82
14 -25.5004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  11  11.GGSQATWNPGGLDIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTGTSAPWQPGGKTLTGTTTYNGEGPIGFKSEVTDGDTY 138
15 -25.2005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  20  19EASYICHCPPSFHGPLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDTHECACLPGFTGQNCEENID 119
16 -25.1004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  12  61TMTYVGEGPIGFRATLTQDQGATLAGTMTYAGEGPIGFKSQQADGGVYAGSSAPWHNGGVWVNGNMTYAGEGPIGFKGNSVAGNNY 215
17 -24.0001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  23  1..SYQVICRDEKTQMIYQQHQSVLRSNRVEYCWCNSGRAQ-CHSVPVKSCSEPRCFNGGTCQQALSDFVCQCPEGFAGKSCEIDTR 89
18 -23.7001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  13  19.............ASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCH 93
19 -21.5004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  61  2..........................................DIVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELL.. 43
20 -21.0004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  27  215KLPGDCRCQYGWQGLYCCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGTQPCLNGGTCSNGPDKYQCSCPEGYSGPNCEI... 304
21 -20.7001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  50  1............................................SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKD 42
22 -20.4004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  11  145.YSYRVVCSDNYYGDSCSRLCKKRDDHFG-SPSCLPGWTGKYCDQPI--CLSGCHEQNGYCS---KPDECNCRPGWQGPLCNEAA. 230
23 -20.3004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  13  176QPDGSPSCLPGWTGKYCDQNGYCSK---PDECNCRPGWQGPLC----NECIPHKGCRHGTCT---IPWQCACDEGWGGLFCDQAAA 261
24 -19.7002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  26  74KLPGDCRCQYGWQGHPGCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGTQPCLNGGTCSNGPDKYQCSCPEGYSGPNCEI... 163
25 -19.6001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  41  2...............................................ASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE 40
26 -19.1001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  27  1.......................................GTSHLVKCAEKEKTFCVNGGECLSNPSRYLCKCQPGFTGARCTENVP 52
27 -18.4003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  21  147........KEGFQG--CLASVDLNGRLPDLISDACNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSTSFSGPLCNDPGT 225
28 -17.6001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  29  1.........................................NSYPGCPSSYDGYCLNGGVCMESLDSYTCNCVIGYSGDRCQTRD. 46
29 -16.6003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  51  2...........................................YKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKN 44
30 -16.5001nl0_G mol:protein length:51 factor IX  ali model follow..  59  2NSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYEEEEE..................................... 50
31 -16.4001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  34  1.........................................NSYPGCPSSYDGYCLNGGVCMESLDSYTCNCVIGYSGDRCE.... 43
32 -16.3005edm_A mol:protein length:568 Prothrombin  ali model follow..  41  1ANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQ.... 87
33 -15.1001cfh_A mol:protein length:47 COAGULATION FACTOR IX  ali model follow..  65  2NSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVD........................................ 47
34 -14.6002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  18  18GSRYNAYCCPGWKTHSCGDGFCSRPNM----CTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDD----HCLCQKGYIGTHCGQPV. 107
35 -14.6001j34_C mol:protein length:46 Coagulation factor IX  ali model follow..  62  2NSGKLEEFVRGNLERECKEEKCSFEEAREVFENTEKTTEFWKQYV......................................... 46
36 -14.1003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  21  147........REPFKG--WIRD---VDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSTGFRGKDCSQGKE 230
37 -14.1005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  44  2...............................................NPCCSHPCQNRGVCMSGFDQYKCDCTTGFYGENCST... 39
38 -13.8002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  20  107.....FPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPG-GCRNGGFCN---ERRICECPDGFHGPHCEGT.. 181
39 -13.8002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  18  16VNATACRCNPGFSSFSCGKFSDCWNTEGSYDCVCSPGYEPVSGAQDVDECSSGQCDSSTVCFNTVGSYSCRCRPGWKPR....... 130
40 -13.7003ltf_D mol:protein length:58 Protein spitz  ali model follow..  36  9...............................................ETFDAWYCLNDAHCIADLPVYSCECAIGFMGQRCEYKE. 50
41 -13.6002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  14  226FYPGKCICPPGLEGEQCEISKCPQP-IGKSKCKCSKGYQGDLCS---KPVCEPGCGAHGTCHE---PNKCQCQEGWHGRHCNKRY. 310
42 -13.5003cfw_A mol:protein length:164 L-selectin  ali model follow..  35  122.................................................CQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVQV 158
43 -13.5001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  29  6..............DECKEHGQCINTDGSYRCECPFGYILAGNEVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEMMTCE.... 82
44 -13.5001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  29  2.............................................GAPSSYDGYCLNGGVAMESLDSYTCNCVIGYSGDRCQ.... 40
45 -13.3001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  37  34...............................................NPCCYYPCQHQGICVRGLDRYQCDCTTGYSGPNCTIP.. 72
46 -12.7001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  23  22SNHFKCMCNEGLVENTCEEENPDPAQVNMYKCGCIEGYTLKEDTCVLDVCQYKNCGESGECISEIQSAGCSCAIGKDEKKCT.... 135
47 -12.5005edk_A mol:protein length:560 Prothrombin  ali model follow..  39  1ANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRS 91
48 -12.4001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  20  3............................................LAQQTCANNQCSVHAECRDYATGFCCRCVANYTGN....... 39
49 -12.4001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  35  16......................................................CLHDGVCMEALDKYACNCVVGYIGERCQ.... 45
50 -12.3003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  35  16......................................................CVNGGECLSNPSRYLCKCPNEFTGDRCQ.... 48
51 -12.1004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  18  187.....RRCEAQKWGPECMNNGVCHEDTGE--CICPPGFMGRTCEKACELCKQEGCKSYVFCLPDPYG--CSCATGWKGLQCN.... 277
52 -12.1001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  35  14......................................................CLHDGVCMEALDKYACNCVVGYIGERCQ.... 43
53 -11.8001lqv_C mol:protein length:33 Vitamin-K dependent protein C  ali model follow..  60  1ANSFLEELRHSSLERECIEEICDFEEAKEIFQN..................................................... 33
54 -11.5005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  20  209.....CRCDTGYIGKNCELEGSCRKDNNSIICS-GKLIYGQYCECDTINCERYNGPGRGLCFCG----KCRCHPGFEGSACQ.... 313
55 -10.9003s94_A mol:protein length:619 Low-density lipoprotein receptor-related prot  ali model follow..  13  527...YWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFDMKTCIV... 610
56 -10.9001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  20  14..................GRGQCVNTPGDFECKCDEGYESGFMMMDIDECQRDPLCRGGVCHNTEGSYRCECPPGHNISAC..... 85
57 -10.7004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  18  426......KCFFYSTVPECLSPTTMAFTSLSAVDPSIAIDPDSIAVLPEDKCVSVDCGAHGTCDV--ATGKCVCEPGFTGERCDAAAL 505
58 -10.4001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  26  1............................................TDVNECLDPTTCISGNCVNTPGSYICDCPPDFTRVGCV.... 42
59 -10.4002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  17  285EHSLGESAAQGAAGENTRTKESCQAIKE--YMDTTLGPFILNVTSGALLCSQALCSGHGRCAQMAVEFKCRCYPGWQAPWCE.... 411
60 -10.4002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  18  5.SDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLEDIDECQDPDTCSQ-LCVNLEGGYKCQCEEGFHTKACK.... 101
61 -10.3002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  24  1............................................SDVNECLTIPCKGEMKCINHYGGYLCLPRSAAV......... 35
62 -10.3002k2s_B mol:protein length:61 Micronemal protein 6  ali model follow..  35  14.................................................CSSNPCEAAGTCKETNSGYICRCNQGYR......... 43
63 -10.3005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  28  185.........................................ECRCRDQSRDRSLCHGKGFLECG----ICRCDTGYIGKNCEHH.. 223
64 -10.2001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  10  9.............KKQCPQNSGCFRHLEREECKCLLNYKQ-TCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDSGIFCS.... 93
65 -10.1005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  25  33...............................................TKCSSD-CLHGQCILVDMSQNYCRCEVGYTGVRCE.... 71
66 -10.1002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  15  195.............RSLCHGKGFLE------ICRCDTGYIGKNCECQTQSCRKDNCSGLGDCVCG----QCLCHTSIYGQYCE.... 274
67 -9.9302w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  20  21PGSFICECSSESTKTICIIKGTCWQTVIDGRCEININGATLKSQEDIDECEVFPVCKNGLCVNTRGSFKCQCPSGMTGRIC..... 146
68 -9.8302mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  14  12..............RDIPKNAGCFRDDGTKEWRCLLGYKKGEGNNNNPTCDINNCDPTASCQNAESTIICTCKEPTPNAYYE.... 91
69 -9.6901xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  31  38...............................................DPCLRK-CIH-GECKKELRAPSCICHPGYHGERCH.... 76
70 -9.6701ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  10  9.............KKQCPQNSGCFRHLEREECKCLLNYKQ-TCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDSGIFCS.... 93
71 -9.4903kl6_B mol:protein length:57 Coagulation Factor X light chain  ali model follow..  24  3.............................................ARKLCSLDNGDCDQFCHEEQNSVVCSCARGYNGKACI.... 43
72 -9.4702gd4_L mol:protein length:58 Coagulation factor X, Stuart factor, Stuart-P  ali model follow..  25  3...............................................KLCSLDNGDCDQFCHEEQNSVVCSCARGYNGKACI.... 41
73 -9.4501g1q_A mol:protein length:162 P-SELECTIN  ali model follow..  26  87.............NEDCVESPSAPGKWNDEHCLKKKHAL---CYTA--SCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRD 158
74 -9.4404ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  12  498.LECEECGGLGSPTGRCEGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQD-KAGYGTCNCFPEEEKCFCEPEIQDPLCDELCR 607
75 -9.3701b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  16  3.............................................SEHRCIDTNVPENAACYRYLGTEEWRCLLYFDAGKCV.... 42

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.