current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
2 -26.0004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  22  22SFSCECPDGFTDPNCSSGPCTPNPCHNGGTCYVCKCPRGFNGICQHNINECEVEPCKNGGICTDLV--ANYSCECPGEFMGRNCQYKGGG. 137
3 -25.7004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  22  24SFECQCLQGYTGPRCEVNECISNPCQNDATCFQCICMPGYEGYCEINTDECASSPCLHNGRCVDKI--NEFLCQCPKGFSGHLCQSGRL.. 119
5 -24.7004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  19  178DGSPSCLPGWTGKYCDQPICLSGCHEQNGYCDECNCRPGWQG---PLCNECIPHKGCRHGTCT-----IPWQCACDEGWGGLFCDQAAA.. 261
10 -23.7004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  23  406AYLCRCQAGFSGRHCDVDDCASSPCANGGTCFSCTCPPGYTGNCSAPVSRCEHAPCHNGATCHQRG--HGYVCECARSYGGPNCQFLLP.. 501
12 -23.1001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  21  3SFLEEMKKGHLERECMEETCSYEEAREVFE---DSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGL--GEYTCTCLEGFEGKNCELFTR.. 86
14 -22.7004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  17  146SYRVVCSDNYYGDSCSRLCKKRDDHFGHYECQSPSCLPGWTGKYC-DQPICLSGCHEQNGYCS-----KPDECNCRPGWQGPLCNEAA... 230
15 -22.7004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  13  52TYNGEGPIGFRGTLSSANGGTSAPWQPGGVWYNGEGPIGFKSEVTDNQWGGSAAPWHSGGVWVLLSGTMTYNGEGPIGFRGTLTSPDTYTV 207
18 -19.3001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  22  10................VRGNLERECIEEKCSFEENTEKTNEFKQYVDGDQCEPNPCLNGGLCKDDI--NSYECWCQVGFEGKNCELDATCN 89
21 -17.6001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  23  1..........................................NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRD... 46
23 -17.0003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  29  181...........................................CEGPSTTCQEDSCSNQGVCLQQ--WDGFSCDCSTSFSGPLCNDPGTTY 227
24 -16.7001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  29  4...........................................HLVKCAEKEKTFCVNGGECFDLSNPSRYLCKCQPGFTGARCTENVPMK 54
25 -16.6001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  28  2...........................................SYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCE...... 43
27 -15.9004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  38  2...........................................DIVDGDQCESNPCLNGGSCKDDI--NSYECWCPFGFEGKNCELL.... 43
28 -15.8002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  23  57..MCTCPSGQIAPSCGSRQHCNIRCMNGGSCSHCLCQKGYIGTHCG--QPVCESGCLNGGRCV-----APNRCACTYGFTGPQCE...... 136
29 -15.6001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  30  1.............................................SDGDQCASSPCQNGGSCKDQL--QSYICFCLPAFEGRNCETHKD.. 42
31 -14.8005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  30  2................................................NPCCSHPCQNRGVCMS-VGFDQYKCDCTTGFYGENCSTPEFLT 44
32 -14.5001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  30  1...............................................TASCQDMSCSKQGECLETI--GNYTCSCYPGFYGPECEYVRE.. 40
33 -14.2001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  25  2..............................................GAPSSYDGYCLNGGVAMHIESLDSYTCNCVIGYSGDRCQ...... 40
34 -14.2001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  27  33...............................................VNPCCYYPCQHQGICVRF-GLDRYQCDCTTGYSGPNCTIPEIWT 76
35 -13.7001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  26  16.......................................................CLHDGVCMYIEALDKYACNCVVGYIGERCQ...... 45
36 -13.4001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  26  14.......................................................CLHDGVCMYIEALDKYACNCVVGYIGERCQ...... 43
37 -13.4003ltf_D mol:protein length:58 Protein spitz  ali model follow..  25  9................................................ETFDAWYCLNDAHCFKIADLPVYSCECAIGFMGQRCEYKE... 50
38 -13.2003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  25  3.............................................KGGSPCISQPCLHNGSCQDSI--WGYTCTCSPGYEGSNCELAKNEC 46
39 -13.2003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  30  191................................................EEGEGGVCLNGGVCSV--VDDQAVCDCSTGFRGKDCSQGKEEY 232
40 -12.8004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  18  230..EKACELHTFGRTCKERCSGQEGCKSYVFCLGCSCATGWKGLQCNEAPDCKLRSCNNGEMCDRFQG-----CLCSPGWQGLQCERE.... 321
41 -12.5005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  14  208..ICRCDTGYIGKNCECQTQGRSSCSGLGDCVQCLCHTSDVPGKLIYGQYCECDTGPGRGLCFCG------KCRCHPGFEGSACQ...... 313
42 -12.1003cfw_A mol:protein length:164 L-selectin  ali model follow..  18  100..........................DAGKWNDDACHKLKAALCYTAS--CQPWSCSGHGECVEII--NNYTCNCDVGYYGPQCQFVQVDP 160
43 -12.1005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  22  4...................MSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSD-CLHGQ-CIYLVDMSQNYCRCEVGYTGVRCE...... 71
44 -11.8001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  24  38................................................DPCLRK-CIH-GECKYVKELRAPSCICHPGYHGERCH...... 76
45 -11.7004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  16  339DHETKCPPREPLKNVRMNARASLSNATAEQCSSADGSSLSSQVAVLPEDKCVSVDCGAHGTCDV----ATGKCVCEPGFTGERCDAAALV. 506
46 -11.5003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  40  16.......................................................CVNGGECFDLSNPSRYLCKCPNEFTGDRCQ...... 48
47 -11.3002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  25  326.....................................GPFILNVTSGALLCSQALCSGHGRCVRAQMAVEFKCRCYPGWQAPWCE...... 411
48 -11.3001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  17  24HFKCMCNEGLVHLS-EFGQCIENPDPAQVNMYKCGCIEGYTKEDTCVLDVCQYKNCGESGECIVLSEIQSAGCSCAIGKVEKKCT...... 135
49 -10.9001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  24  10...............EPDVCKHGQCINTDGSYRCECPFGYIGNECVDTDECSVGNPCGNGTCKNVI--GGFECTCEEGFEMMTCE...... 82
50 -10.9003qh0_A mol:protein length:610 Prostaglandin G/H synthase 2  ali model follow..  30  11........................................ALGLSQAANPCCSNPCQNRGECMST-GFDQYKCDCTTGFYGENCTT..... 56
53 -10.5001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  18  2............................................PLAQQTCANNQCSVHAECRDY--ATGFCCRCVANYTGN......... 39
54 -10.3002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  20  181LPQCECR-------CRDQSRDRSLCHGKGFLEICRCDTGYIGSSQELEGSCRKDNCSGLGDCV--------QCLCHTSIYGQYCE...... 274
56 -10.2002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  16  4...............SEHTCIDTNVPDNAACEEWRCLLTFKECVPASNVTCKDNNCAPEAECKMT-DSNKIVCKCTKEGSE.......... 81
58 -10.1002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  20  12......................RDIPKNAGCKEWRCLLGYKTCVENNNPTCDINNCDPTASCQNAESTKKIICTCKEPTPNAYYE...... 91
60 -9.9803ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  34  430................................KCCCSPGWEGDFCRTAK--CEPACRHGGVCVRPN-----KCLCKKGYLGPQCE...... 475
61 -9.8801z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  22  13...................CGTAVCKNIPGDFECECPEGYRSKSCEDIDECSENMCAQ--LCVNYPGGYTCYCDGKKGFKQKSCE...... 84
63 -9.8305e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  29  183................................QCEC--------RCRDQSRDRSLCHGKGFLE--------ICRCDTGYIGKNCEHH.... 223
64 -9.7501lmj_A mol:protein length:86 fibrillin 1  ali model follow..  17  11.................DLCGRGQCVNTPGDFECKCDEGYEMKNCMDIDECQRDPLCRGGVCHNTE--GSYRCECPPGHQISAC....... 85
65 -9.5802mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  25  28...............................EEWRCLLGYKTCVENNNPTCDINNCDPTASCQNAENSKKIICTCKEPTPGVFCS...... 96
66 -9.5701mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  34  16.......................................................CFHGT-CRFLVQEDKPACVCHSGYVGARCE...... 44
68 -9.4401iox_A mol:protein length:50 Betacellulin  ali model follow..  34  16.......................................................CIKGR-CRFVVAEQTPSCVCDEGYIGARCE...... 44
69 -9.3701n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  16  9...............SAHKCIDTNVPENAACEEWRCLLGFKEKCVPASITCEENNCAPEAECTMD-DKKEVECKCTKEGSE.......... 85
70 -9.3603gis_X mol:protein length:121 Thrombomodulin  ali model follow..  23  23SYLCVCAEGFAPIPHEPHRCQLPADCDPNTQASCECPEGYI----DDGFICTDDECENGGFCSGHNLPGTFECICGPDSA........... 109
72 -9.2702rnl_A mol:protein length:50 Amphiregulin  ali model follow..  24  20.......................................................CIHGE-CKYIEHLEAVTCKCQQEYFGERCG...... 48
73 -9.2201yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  15  2...............DPDGCLSNPCFPGAQCWSCFCPVGFLGTHCEDLDECALVSTSKVPRCVNTQ--PGFHCPCPPRYRGNQPVGVGLEA 91
74 -9.1203soq_A mol:protein length:318 Low-density lipoprotein receptor-related prot  ali model follow..  26  267...............................................TNPCGIDNCSH--LCLMSPVKPFYQCACPTGVKGKTCK...... 308
75 -9.1103s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  19  567...........................................KELNLQEYRQHPCQDNGGCSHIKGDGTTRCSCPMHLVELSC....... 615

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 8 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang B, Jaroszewski L, Rychlewski L, Godzik A. Similarities and differences between nonhomologous proteins with similar folds: evaluation of threading strategies. Fold Des. 1997;2(5):307-17.