current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1pfx_L mol:protein length:146 FACTOR IXA, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst YNSGKLEEFVRGNLERECIEEKCSFEEAREVFENTEKTNEFWKQYVDGDQCEPNPCLNGGLCKDDINSYECWCQVGFEGKNCELDATCNIKNGRCKQFCKTGADSKVLCSCTTGYRLAPDQKSCKPAVPFPCGRVSVSHSPTTLTRLast
1 -63.5001pfx_L mol:protein length:146 FACTOR IXA  ali model  100  1YNSGKLEEFVRGNLERECIEEKCSFEEAREVFENTEKTNEFWKQYVDGDQCEPNPCLNGGLCKDDINSYECWCQVGFEGKNCELDATCNIKNGRCKQFCKTGADSKVLCSCTTGYRLAPDQKSCKPAVPFPCGRVSVSHSPTTLTR 146
2 -51.5001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  47  1......EEMKKGHLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKRSVAQ 141
3 -47.4001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  48  2..NAFLEELRPGSLERECKEEQCSFEEAREIFKDAERTKLFWISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEK...... 143
4 -43.3001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  50  2..NSFLEEMKKGHLERECMEETCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTL......... 137
5 -42.3002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  17  10............LGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLHHILDAQKMVWN.......... 133
6 -40.6004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  17  377YSGFNCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHQRGHGYVCECARSYGGPNCQFLLPELPPGPAVVDLTEKLEGQGGP 522
7 -40.3005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  14  1......SAQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYN 143
8 -39.8005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  14  2..........DPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGEKPCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYN 140
9 -39.2004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  18  7............LGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCVDKINEFLCQCPKGFSGHLCQSGRLEVLFQ................ 124
10 -37.3001fax_L mol:protein length:96 FACTOR XA  ali model follow..  43  1............................................YKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKCSLDNGDCDQFCHEEQASVVCSCARGYTLADNGKACIPTGPYPCGKQTLER....... 96
11 -36.8001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  28  13..............................................PLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSH. 113
12 -33.5004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  19  1..........DICDPNPCENGGICLPGLGSFSCECPDGFTDPNCSSVVGPCTPNPCHNGGTCEDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKGG..................... 136
13 -33.4001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  63  2..NSFLEEVKQGNLERECLEEACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTR........................................................... 86
14 -32.0004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  46............ALNIKSGDGGRTLTGTMTYVGEGPIGFRATLTQSNTYAGSSAPWHPGGTWVAGTMTYAGEGPIGFKSQQADGGVYAGSSAPWHNGGVWVNGNMTYAGEGPIGFKGNSVAGNNYAGTSAPWHPGGIW........ 234
15 -31.0004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  35............ALDIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTGTSAPWQPGGKTLTGTTTYNGEGPIGFKSEVTDGDTYSVENQKSNDGGKTLSGTMTYNGEGPIGFRGTLTSPDTYTVSTAPWNPGGFW........ 224
16 -30.8004bxs_A mol:protein length:423 FACTOR X-LIKE PROTEASE  ali model follow..  50  1.ANSLVEEFKSGNIERECIEERCSKEEAREVFEDDEKTETFWNVYVDGDQCSSNPCHYRGICKDGIGSYTCTCLSGYEGKNCERVLYKSCRNGNCWHFC-KHVQNDIQCSCAEGYLLGEDGHSCVAGGNFSCGRNIKTRNKR.... 142
17 -26.0004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  15  154YYGDSCSRLC--KKRDDHFGHYECQPDGS---PSCLPGWTGKYC--DQPICLSGCHEQNGYCSK---PDECNCRPGWQGPLCNE----CIPHKGCRHGTCT---IPWQCACDEGWGGLFCDQAAA..................... 261
18 -25.8004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  16  193WMGPECNRAI--CRQGCSPKHGSCKL---PGDCRCQYGWQGLYC----DKCIPHPGCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGTHQPCLNGCSNTGPDKYQCSCPEGYSGPNCEIV....................... 305
19 -25.4004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  21  2.....SEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTAA.......................................................... 85
20 -25.0003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  41  2............................................YKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHRTDGCQHFCLPGQ-ESYTCSCAQGYRLGEDHKQCVPHDQCACGV............ 92
21 -24.4002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  16  19YYGFGCN---KFCRPRDDFFGHYACD--QNGNKTCMEGWMGPECNRAI--CRQGCSPKHGSCKL---PGDCRCQYGWQGLYCD----KCIPHPGCVHGICNE---PWQCLCETNWGGQLCDKDLNYCGTHPCLNGGTCSN...... 142
22 -20.5001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  18  1............................................EAEASAVTVDTICKNGQLVQMSNHFKCMCNEGLSENTCEEKNECCGEFGQCIENPDPAQVNMYKCGCIEGYTLKEDTCVLDVCQYKNCGESGECI....... 106
23 -19.9004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  10  146.............................SYRVVCSDNYYGDSCSRLCKK--RDDHFGHYECQP---DGSPSCLPGWTGKYCDQPI--CLSGCHEQNGYCS---KPDECNCRPGWQGPLCNEAA...................... 230
24 -19.9001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  27  1.............................................TDIDECRISP-CGRGQCVNTPGDFECKCDEGYEMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISAC...................... 85
25 -19.6001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  25  1........................................GTSHLVKCAEKEKTFCVNGGECLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK............................................ 67
26 -19.3001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  22  17.........QHQSWLRPVLRSNRVEY------CWCNSGRAQ-CHSVPVKSCSEPRCFNGGTCQQALSDFVCQCPEGFAGKSCEIDTRAT......................................................... 91
27 -19.2002ygq_A mol:protein length:324 WNT INHIBITORY FACTOR 1  ali model follow..  19  173FHGPHCEKAL---CTPRCMNGGLCVTPGF---CICPPGFYGVNCDKAN---CSTTCFNGGTCFY---PGKCICPPGLEGEQCEISK---CPQPCRNGGKCI---GKSKCKCSKGYQGDLCSKPV---CEPGCGAHGTCHE...... 291
28 -19.1001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  24  3.............................................VDMDECKEPDVCKHGQCINTDGSYRCECPFGYAGNECV-DTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMT........................ 80
29 -19.0001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  50  1.............................................SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDGSA....................................................... 46
30 -18.4002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  15  5.............CARWCPQDSSCVNA---TACRCNPGFSSFETCDDINECATLSCGKFSDCWNTEGSYDCVCSPGYEENTCQ-DVDECSSGQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQK.................... 138
31 -18.4004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  83  2...........................................DIVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELL............................................................. 43
32 -18.4002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  23  43.............CRHSCGDGFCSRPNM----CTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDD----HCLCQKGYIGTHCGQPV---CESGCLNGGRCVAPN---RCACTYGFTGPQCE......................... 136
33 -18.2002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model follow..  24  1........................MKPMSDYDIPTTENLYFQGA-MGTNECLDNNGGCSHVCNDLKIGYECLCPDGFAQRRCE-DIDECQDPDTCSQ-LCVNLEGGYKCQCEEGFQLDPHTKACK..................... 101
34 -18.2001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  27  1.............................................TDVNECLDPTTCISGNCVNTPGSYICDCPPDFETVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD..................... 162
35 -18.1001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  16  3.............................................LAQQTCANNQCSVHAECRDYATGFCCRCVANYNGRQCVAEGSPQRVNGGRIFVGSSQVPVVFENTDLHSYVVMNHGRSYTAISTIP............... 95
36 -17.6003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  18  147......KEGFQGCLASVDLNGRLPDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSTSFSGPLCNDPGTTYI........................................................ 228
37 -17.5002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  31  2.............................................ADIDECESSPCIN-GVCKNSPGSFICECSSESKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRIC...................... 146
38 -16.4003gcw_E mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  29  4..............................................GTNECLDNNGGCSYVCNDLKIGYECLCPDGFAQRRCE-DIDECQDPDTCSQ-LCVNLEGGYKCQCEEGFQLDPHTKACK..................... 83
39 -16.4004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  23  187................................RRCEAQKWGPECN---HLCTA--CMNNGVCHEDTG--ECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGDPYGCSCATGWKGLQCNEACHP-LRCSCNNGEMCDRFQG... 306
40 -16.2001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  33  2................................................ASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRE........................................................... 40
41 -15.9001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  18  3..............................................SQHQCVKKQCPQNSGCRHLDEREECKCLLNYKQETCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDS.............................. 83
42 -15.8001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  28  1..........................................NSYPGCPSSYDGYCLNGGVCMESLDSYTCNCVIGYSGDRCQTRDLRWWEL...................................................... 52
43 -15.4001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  18  3..............................................SQHQCVKKQCPQNSGCRHLDEREECKCLLNYKQETCNENNGGCDADAKCTEEDSGSNGKKITCECTKPDS.............................. 83
44 -15.1005edm_A mol:protein length:568 Prothrombin  ali model follow..  27  1.ANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGADQENFCRNPDSSTMGPWCYTTDPTVRRQECSIPVCGQ...... 145
45 -15.0002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  14  1.............................................SDVNECLTIPCKGEMKCINHYGGYLCLPRSAAVINDLHG-----------EGPPPPVPPAQHPNPCPPGYEPDDQDSCVD..................... 71
46 -15.0001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  19  8.............................................SSAHKCIDTNVPENAACYRYLGTEEWRCLLGFKGGKCVPASITCEENNG-EAECTMDDKKEVECKCTKEGSE............................. 85
47 -15.0001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  15  3.........PDGCLSNPCFPGAQCSSFPDGSWGFCPVGFLGNGTHEDLDECALVSTSKVPRCVNTQPGFHCPCPPRYRGNQCKDKTHNCHKHAECIY-LGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHC 168
48 -15.0001z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  30  1.............................................KDVDECSLKP-CGTAVCKNIPGDFECECPEGYKSKSCE-DIDECSENMC--AQLCVNYPGGYTCYCKKGFKLAQDQKSCEV.................... 85
49 -14.9002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  38  148................................................QAECPGGCRNGGFCN---ERRICECPDGFHGPHCEGT............................................................. 181
50 -14.7003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  18  2.......EPVDPCFRANC-EYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQLFCNQTACPADC-DPNTQASCECPEGYDGFICT-DIDECENGGFCSG-VCHNLPGTFECICGPDSALAGQIGTD...................... 117
51 -14.6001nl0_G mol:protein length:51 factor IX  ali model follow..  82  1YNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYEEEEE................................................................................................ 50
52 -14.5003v65_B mol:protein length:386 Low-density lipoprotein receptor-related prot  ali model follow..  29  1.............................................TGEENCNVNNGGCAQKCQMIRGAVQCTCHTGYDGRTCQ-DVNECAEEGYCSQGCTNSE-GAFQCWCEAGYELRPDRRSCKALGPEP............... 88
53 -14.5001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  15  3..............................................SEHRCIDTNVPENAACYRYDGTEEWRCLLYFKEDTCKDKNGGCAPEA----ECKMNDKNEIVCKCTKEGS.............................. 79
54 -14.3002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  18  4..............................................PKHVCVDRDIPKNAGCRDDDGTEEWRCLLGYKKPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTP.............................. 86
55 -14.1002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  16  3.............................................SSEHTCIDTNVPDNAACYRYLGTEEWRCLLTFKEETCKDNNGGCAPEA----ECKMTDSNKIVCKCTKEGSE............................. 81
56 -14.1001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  36  1..........................................NSYPGCPSSYDGYCLNGGVCMESLDSYTCNCVIGYSGDRCE............................................................... 43
57 -13.9002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  19  4..............................................PKHVCVDRDIPKNAGCRDDDGTKEWRCLLGYKKPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNA............................ 88
58 -13.4001cfh_A mol:protein length:47 COAGULATION FACTOR IX  ali model follow..  91  1YNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVD................................................................................................... 47
59 -13.4003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  20  142.ASVREREPFKGWIRDVRVNSS--VDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSTGFRGKDCSQGKE........................................................... 230
60 -13.3003cfw_A mol:protein length:164 L-selectin  ali model follow..  35  120................................................ASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVQVD.......................................................... 159
61 -13.2004yzu_B mol:protein length:62 Coagulation factor IX  ali model follow..  74  4......................................................................................TCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT.. 61
62 -13.1005edk_A mol:protein length:560 Prothrombin  ali model follow..  25  2..NTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLRSRYPHKPEINSTTHPGADLQENFCRNPDSSTMGPWCYTTDPTVRRQECSIPVCGQEQ.... 147
63 -13.0001rfn_B mol:protein length:57 PROTEIN (COAGULATION FACTOR IX)  ali model follow..  78  1.....................................................................................MTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQT...... 55
64 -13.0002qn5_B mol:protein length:133 Bowman-Birk type bran trypsin inhibitor  ali model follow..  14  6.................................................KCCDNIKRLPTKPDPP----QWRCNDELEPSQCTAACKSCREAPGPFPG---------KLICEDIYWGADPGPFCTPRPWGDCCDKAFCNK...... 83
65 -12.8001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  18  2.......EPVDPCFRANC-EYQCQPLDQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADC-DPNTQASCECPEGYDGFICT-DIDECENGGFCSG-VCHNLPGTFECICGPDSALAGQI......................... 114
66 -12.6001j34_C mol:protein length:46 Coagulation factor IX  ali model follow..  95  1YNSGKLEEFVRGNLERECKEEKCSFEEAREVFENTEKTTEFWKQYV.................................................................................................... 46
67 -12.4003ltf_D mol:protein length:58 Protein spitz  ali model follow..  31  9................................................ETFDAWYCLNDAHCIADLPVYSCECAIGFMGQRCEYKEIDNTYLP..................................................... 57
68 -12.2005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  37  2................................................NPCCSHPCQNRGVCMSGFDQYKCDCTTGFYGENCSTP............................................................. 40
69 -11.6001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  32  2..............................................GAPSSYDGYCLNGGVAMESLDSYTCNCVIGYSGDRCQ............................................................... 40
70 -11.6005e6w_A mol:protein length:317 Integrin beta-2  ali model follow..  12  186.....CRCRDQSRDRSLCHGKGFLE------ICRCDTGYIGKNCECQTQGRSSQECSGLGDCVCG----QCLCHTSIYGQYCECDTINCERYGGPGRGLCFCG----KCRCHPGFEGSACQ......................... 313
71 -11.5001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  31  33...............................................VNPCCYYPCQHQGICVRGLDRYQCDCTTGYSGPNCTIP............................................................. 72
72 -11.4004z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  358VSKGKYCKPMNARASLSNATAEQCGQRLMLSSADGSSLSSQVRGYHWATFVATDCNMGRGKCFFYSTVPECLIHAIDPDSIAVLPEDKCVSVDCGAHGTCDV--ATGKCVCEPGFTGERCDAAAL------VPR............ 508
73 -11.3004zlp_A mol:protein length:271 Neurogenic locus notch homolog protein 3  ali model follow..  10  3..........EVSEEPRCPRAACQAKRGDQR---CDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFRCDPACSSPACLYDNFDCHAGNPVYEKYCADHFADGRCTEECGWDGLDCASEVPA.................... 129
74 -11.3001dqb_A mol:protein length:83 THROMBOMODULIN  ali model follow..  23  3.............................................EPVDPCFRANCEY--QCQPNQTSYLCVCAEGFAIPHEPHRCQMFCNQTACPADCDPN--TQASCECPEGYILDD........................... 74
75 -11.3002p26_A mol:protein length:280 Integrin beta-2  ali model follow..  20  186...........................................CRCRDQSRDRSLCHGKGFLE------ICRCDTGYIGKNCECQTQG--RSSQELEGSCRKDNNSIICSCVCG................................ 254

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;