current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
1 -34.1001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model  100  1VVSHFNDCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWEL 54
2 -32.0001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  90  1..NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWEL 52
3 -27.8003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  25  2.TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSCKCPNEFTGDRCQNYVMASF.. 55
4 -27.4001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  54  1VVSHFNDCPDSHTQFCFH-GTCRFLVQEDKPACVCHSGYVGARCEHADLLA... 50
5 -26.6001iox_A mol:protein length:50 Betacellulin  ali model follow..  38  2.KGHFSRCPKQYKHYCIK-GRCRFVVAEQTPSCVCDEGYIGARCERVDLFY... 50
6 -25.8001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  57  1..NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCEHADLLA... 49
7 -25.5005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  37  28AQVSITKCSSDMNGYCLH-GQCIYLVDMSQNYCRCEVGYTGVRCEHFFL..... 75
8 -25.5001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  63  2......GAPSSYDGYCLNGGVAMHIESLDSYTCNCVIGYSGDRCQTRDLR.... 45
10 -24.8002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  36  5SSGKKNPCNAEFQNFCIH-GECKYIEHLEAVTCKCQQEYFGERCGEK....... 50
12 -21.0001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  26  2.TSHLVKCAEKEKTFCVNGGECFMVKDLSNYLCKCQPGFTGARCTENVPMKVQ. 56
13 -19.5003ltf_D mol:protein length:58 Protein spitz  ali model follow..  32  1.TFPTYKCPETFAWYCLNDAHCFAVKIADVYSCECAIGFMGQRCEYKEIDNTYL 56
14 -13.7001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  26  56...............CFNGGTCQQALYFSDFVCQCPEGFAGKSCE......... 85
15 -12.4004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  46  53...............CLHGGRC--LEVEGHRLCHCPVGYTGPFCD......... 80
16 -12.4001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  35  55...............CLNQGHCK--DGIGDYTCTCAEGFEGKNCE......... 82
17 -11.8002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  28  155...............CRNGGFC-----NERRICECPDGFHGPHCEGTK...... 182
18 -11.6001fax_L mol:protein length:96 FACTOR XA  ali model follow..  34  5.....DQCETS----CQNQGKC--KDGLGEYTCTCLEGFEGKNCE......... 39
19 -11.5004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  35  14...............CLNGGSC--KDDINSYECWCPFGFEGKNCE......... 41
20 -11.5001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  37  9...............CSKQGEC--LETIGNYTCSCYPGFYGPECEY........ 37
21 -11.3001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  32  11...............CQNGGSC--KDQLQSYICFCLPAFEGRNCE......... 38
22 -11.0004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  10  251...............SGDNGNT--FHGSMTYSGEGPIGFRAMALPQ........ 279
23 -10.8004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  26  8...............CENGGICLPGLADGSFSCECPDGFTDPNCS......... 37
24 -10.7001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  34  43.....DQCETS----CQNQGKC--KDGLGEYTCTCLEGFEGKNCE......... 77
25 -10.7001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  34  22...............CCGHGTC--IDGIGSFSCDCRSGWEGRFCQR........ 50
26 -10.7001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  34  49.....DQCEPN----CLNGGLCK--DDINSYECWCQVGFEGKNCE......... 83
27 -10.7004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  14  174...............SNDGGKT--LSGTMTYNGEGPIGFRGTLTS......... 201
28 -10.6001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  34  55...............CQNQGKCK--DGLGEYTCTCLEGFEGKNCEL........ 83
29 -10.5003cfw_A mol:protein length:164 L-selectin  ali model follow..  34  105...NDDACHKLKAALCYTAGEC--VEIINNYTCNCDVGYYGPQCQFV....... 156
30 -10.4003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  26  186.....TTCQED----CSNQGVC--LQQWDGFSCDCSTSFSGPLCNDP....... 223
31 -10.1001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  32  55...............CQNGGSCK--DQLQSYICFCLPAFEGRNCE......... 82
32 -10.0004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  22  223.....PLCNECIPHKGCRHGTC-----TIPWQCACDEGWGGLFCD......... 257
33 -9.7004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  42  12...............CEHAGKC--LNTLGSFECQCLQGYTGPRCE......... 39
34 -9.6604cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  43  275...............CLNGGTCS--TGPDKYQCSCPEGYSGPNCEIVD...... 306
35 -9.5304xl1_B mol:protein length:230 Delta-like protein  ali model follow..  25  184.......CLPGWTG-HEQNGYC-----SKPDECNCRPGWQGPLCNE........ 228
36 -9.1902m74_A mol:protein length:136 Fibrillin-1  ali model follow..  36  112...............CLNGGRC-----VAPNRCACTYGFTGPQCE......... 136

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 8 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.