current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1iox_A mol:protein length:50 Betacellulin, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst RKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLast
1 -34.3001iox_A mol:protein length:50 Betacellulin  ali model  100  1RKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY 50
2 -31.3001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  51  2.VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADL.. 48
3 -29.5002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  26  6.SGKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEK.... 50
4 -27.7005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  31  29.QVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL.. 75
5 -26.7001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  36  34.GKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLS... 79
6 -26.6001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  38  2.VSHFNDCPLSHDGYCLHGVCMYIEALDKYACNCVVGYIGERCQYRDLKW 51
7 -26.0001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  37  1..NSDSECPLSHDGYCLHGVCMYIEALDKYACNCVVGYIGERCQYRDLKW 49
8 -22.5003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  29  2.TSHLVKCAEKEKTFCVNGECFMVKDLSNPSCKCPNEFTGDRCQNYVM.. 52
9 -22.2001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  33  3.......APSSYDGYCLNGGAMHIESLDSYTCNCVIGYSGDRCQTRDLR. 45
10 -21.6001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  36  1..NSYPGCPSSYDGYCLNGGCMHIESLDSYTCNCVIGYSGDRCEHADL.. 47
11 -18.6001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  34  1..NSYPGCPSSYDGYCLNGVCMHIESLDSYTCNCVIGYSGDRCQTRDLR. 48
12 -15.7001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  31  2.TSHLVKCAEKEKTFCVNGECFMVKDLSNPLCKCQPGFTGARCTENVP.. 52
13 -14.0003ltf_D mol:protein length:58 Protein spitz  ali model follow..  27  1.TFPTYKCPETFAWYCLNDAHCFIADLPVYSCECAIGFMGQRCEYKEID. 52
14 -9.6703cfw_A mol:protein length:164 L-selectin  ali model follow..  32  105...NDDACHKLKAALCYHGEC--VEIINNYTCNCDVGYYGPQCQFV.... 156
15 -9.4401tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  34  56...............CFNGGCQQALYFSDFVCQCPEGFAGKSCE...... 85
16 -9.4304bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  27  40.......CQRLASQACRTNPCLHLEVEGHRLCHCPVGYTGPFCD...... 80

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.