current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1hre_A mol:protein length:67 HEREGULIN ALPHA, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
2 -26.1003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  81  1GTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMAS............. 54
3 -22.4001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  26  1..NSYPGCPSSYDGYCLNGGVCMHIESLDS---YTCNCVIGYSGDRCQTRDLRWWELR......... 53
4 -21.0001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  26  2.VSHFNDCPLSHDGYCLHDGVCMYIEALDK---YACNCVVGYIGERCQYRDLKWWE........... 53
5 -21.0001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  28  1..NSYPGCPSSYDGYCLNGGVCMHIESLDS---YTCNCVIGYSGDRCEHADLLA............. 49
6 -20.6004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  21  35GPRCEIDVNECISNPCQNDATC-----LDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGRCV. 95
7 -20.6001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  23  1..NSDSECPLSHDGYCLHDGVCMYIEALDK---YACNCVVGYIGERCQYRDLKWWE........... 51
9 -19.6001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  25  41FWKQYVDGDQCEPNPCLNGGLC-----KDDINSYECWCQVGFEGKNCELDATCNIKNGRCKQFCKTG 102
10 -19.3003ltf_D mol:protein length:58 Protein spitz  ali model follow..  28  9........ETFDAWYCLNDAHCFAVKIADL-PVYSCECAIGFMGQRCEYKEIDNTYLP......... 57
11 -19.1001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  27  40FWSKYKDGDQCEGHPCLNQGHC-----KDGIGDYTCTCAEGFEGKNCEFSTR............... 86
12 -19.0001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  21  40FWISYSDGDQCASSPCQNGGSC-----KDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQ. 100
14 -18.7001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  27  2......GAPSSYDGYCLNGGVAMHIESLDS---YTCNCVIGYSGDRCQTRDLR.............. 45
16 -18.2004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  22  417GRHCDDNVDDCASSPCANGGTC-----RDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHQ 478
17 -18.1001fax_L mol:protein length:96 FACTOR XA  ali model follow..  20  2.....KDGDQCETSPCQNQGKC-----KDGLGEYTCTCLEGFEGKNCELFTRKCSLDNGDCDQFCHE 59
18 -18.0004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  23  48...EPTSAGPCTPNPCHNGGTCEISEAYDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICT. 112
19 -17.8004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  12  74ATLTQSNTYAGSSAPWHPGGTWVI-ATLAGTMTYAGEGPIGFKSQQADGGVYAGSSAPWHNGGVW.. 168
20 -17.5005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  27  29.QVSITKCSSDMNGYCLHGQCIY----LVDMSQNYCRCEVGYTGVRCEHFFL............... 75
21 -17.4004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  13  130SEVTDGDTYSGSAAPWHSGGVWVL-KTLSGTMTYNGEGPIGFRGTLTSPDTYTVENQWGGSTAPWNP 220
22 -17.1001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  41  34.GKKRDPCLRKYKDFCIH-GECKYVKELRAP---SCICHPGYHGERCHGLS................ 79
24 -17.0004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  27  42....RLASQACRTNPCLHGGRC-----LEVEGHRLCHCPVGYTGPFCDVDTAA.............. 85
25 -16.9001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  26  1.....SDGDQCASSPCQNGGSC-----KDQLQSYICFCLPAFEGRNCETHKDDGSA........... 46
26 -16.8003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  18  179.RGCEGPSTTCQEDSCSNQGVC-----LQQWDGFSCDCSTSFSGPLCNDPGTTYIFSKGGGQITYK. 239
27 -16.7001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  29  44...HSVPVKSCSEPRCFNGGTCQ---QALYFSDFVCQCPEGFAGKSCEIDTRAT............. 91
28 -16.4004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  35  2...DIVDGDQCESNPCLNGGSC-----KDDINSYECWCPFGFEGKNCE................... 41
29 -16.0001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  30  2.VSHFNDCPDSHTQFCFHGTCRF----LVQEDKPACVCHSGYVGARCEHADLLA............. 50
30 -16.0001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  21  48........DQCETSPCQNQGKC-----KDGLGEYTCTCLEGFEGKNCELFTRKCSLDNGDCDQFCHE 102
31 -15.7001iox_A mol:protein length:50 Betacellulin  ali model follow..  31  2.KGHFSRCPKQYKHYCIK-GRCRFVVAEQTP---SCVCDEGYIGARCERVDL............... 48
33 -15.4002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  33  6.SGKKNPCNAEFQNFCIH-GECKYIEHLEAV---TCKCQQEYFGERCGEK................. 50
34 -14.8001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  35  2........ASCQDMSCSKQGEC-----LETIGNYTCSCYPGFYGPECEYVRE............... 40
35 -14.4002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  35  148........QAECPGGCRNGGFCN--------ERRICECPDGFHGPHCEGT................. 181
36 -13.5004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  28  259GQLCDKDLNYCGHQPCLNGGTCSN----TGPDKYQCSCPEGYSGPNCE................... 303
37 -13.3004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  24  190GKYCDQPI--CLSGCHEQNGYCS--------KPDECNCRPGWQGPLCNEAA................ 230
38 -12.9003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  26  191........EEGEGGVCLNGGVC-----SVVDDQAVCDCSTGFRGKDCSQGKEEYIATFKGSEYF... 242
39 -12.8002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  13  90.......CDKCIPHPGCVHGICN--------EPWQCLCETNWGGQLCDKDLNYCGTQPCLNGGTC.. 140
40 -12.5004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  18  189GKYCDQPI--CLSGCHEQNGYCS--------KPDECNCRPGWQGPLCNE----CIPHKGCRHGTCTI 241
41 -12.4005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  28  2........NPCCSHPCQNRGVCMS----VGFDQYKCDCTTGFYGENCST.................. 39
42 -12.3003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  24  6........SPCISQPCLHNGSCQ-----DSIWGYTCTCSPGYEGSNCELAKNEC............. 46
43 -11.7003cfw_A mol:protein length:164 L-selectin  ali model follow..  28  120........ASCQPWSCSGHGEC-----VEIINNYTCNCDVGYYGPQCQFVQV............... 158
44 -11.7001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  28  34........NPCCYYPCQHQGICVRF----GLDRYQCDCTTGYSGPNCTI.................. 71
45 -11.5003s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  15  567...KELNLQEYRQHPCQDNGGCSHICLVKGDGTTRCSCPMHLVELSC.................... 615
46 -11.5002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  16  331..NVTSGALLCSQALCSGHGRCVRRTSHPKAVEFKCRCYPGWQAPWCERK................. 413
47 -11.0004a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  15  570...KELNLQEYRQHPCQDNGGCSHICLVKGDGTTRCSCPMHLVELSCGG.................. 620
48 -10.9003s2k_A mol:protein length:629 Low-density lipoprotein receptor-related prot  ali model follow..  17  568...KELNLQEYRQHPCQDNGGCSHICLVKGDGTTRCSCPMHLVELSCGE.................. 618
49 -10.5002m74_A mol:protein length:136 Fibrillin-1  ali model follow..  25  66APSCGSRSIQHCNIRCMNGGSC---------SDDHCLCQKGYIGTHCGQPV----ESGCLNGGRCVA 120
50 -9.9801ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  24  56...............CDADAKCTEEDSGSNGKKITCECTKPDSGIFCS................... 93
51 -9.9501cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  22  53............NGGCDADAKCTEEDSGSNGKKITCECTKPDSGIFCS................... 93
52 -9.9005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  18  185..ECRCRDQSRDRSLCHGKGFLE-----------ICRCDTGYIGKNCE................... 221
53 -9.7003ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  36  451...............CRHGGVC--------VRPNKCLCKKGYLGPQCE................... 475
54 -9.6104z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  26  461DSIAVLPEDKCVSVDCGAHGTC-------DVATGKCVCEPGFTGERCDAAAL............... 505
55 -9.3902mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  16  56............NGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYE................... 91
56 -9.3701gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  18  3.....LAQQTCANN-CSVHAEC-----RDYATGFCCRCVANYTGN...................... 39
57 -9.3104k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  20  239GRTCKERCS---QEGCKSYVFC-------LPDPYGCSCATGWKGLQCNEACHPGFYGPCNNGEMCDR 303
58 -9.2103s94_A mol:protein length:619 Low-density lipoprotein receptor-related prot  ali model follow..  22  558GLKATNVHRVIGSNPCEENGGCSHL-CLYRPQGLRCACPIGFEMKTCI................... 609
59 -9.2002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  19  56............NGGCDPTASCQNAESTENSKKIICTCKEPTPGVFCS................... 96

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.