current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst GSHMAPGFTISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLIWLast
1 -111.0001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model  100  1GSHMAPGFTISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLIW 265
2 -95.0003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  36  21........LFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAAR-HSDALQVVADEIAGVGGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGLGGTIITTASMSGHIINIPQ-----QVSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPL-ADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTC. 269
3 -91.6002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  31  1.........MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSPASTSLDATAEEFKAAGINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIML-KQKSGKIINITSIAG-------IIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVLPDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM. 247
4 -91.6002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  31  2...........LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKLGSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMM-RQRHGRIVNIASVVG-------VTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVLDENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM. 246
5 -91.3003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  32  8........KLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADL-DEAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICSEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIML-EQKQGVIVAIGSMSGLIVNRPQ-----QQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTVW 260
6 -91.2004nbv_A mol:protein length:246 3-oxoacyl-[acyl-carrier-protein] reductase pu  ali model follow..  32  1.........MKLQGRVAIITGAAAGIGFATAQRFAEDGAIVVLCD-VQEARVREAAARLAATGATVSAYRVDVTRRDEVDAMVAAVLAAHQRVDILVNNAGITKDARLAKMTEAQFDAVIDVNLKGVFNCAQAVAGLMT-EQGKGVILNASSVVG-------LYGNFGQTNYAASKFGVIGFTKTWARELGPKGVRVNAVCPGFVNTEILQTVPDKVLDGMTSSCWLRRLAEPAEIASIYAFLASDDASYVNGVAIEASGGMSL. 246
7 -91.1003gdf_A mol:protein length:267 Probable NADP-dependent mannitol dehydrogenas  ali model follow..  34  15........QLSLKGKVVVVTGGPKGMGIEAARGCAEMGAAVAITYASRAQGAENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFK-ERGTGSLVITASMSGHIANFPQ-----EQTSYNVAKAGCIHMARSLANEWR-DFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTT. 266
8 -90.8003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  2.....PGSMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLGSGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALI-ASGSGRVVLTSSITGPIT------GYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLENGEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL. 253
9 -90.8003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  31  2...........SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQML-RQRSGAIINLSSVVG-------AVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM. 246
10 -90.6004jro_A mol:protein length:271 FabG protein  ali model follow..  30  11.NLYFQSNAMTLQGKVAVVTGGSRGIGRDIAINLAKEGANIFFNYNGSPEAAEETAKLVAEHGVEVEAMKANVAIAEDVDAFFKQAIERFGRVDILVNNAGITRDNLLMRMKEDEWDDVININLKGTFLCTKAVSRTMM-KQRAGKIINMASVVG-------LIGNAGQANYVASKAGVIGLTKTTARELAPRGINVNAVAPGFITTDMTDKLDEKTKEAMLAQIPLGAYGTTEDIANAVLFLASDASKYITGQTLSVDGGMVM. 265
11 -89.7004iin_A mol:protein length:271 3-ketoacyl-acyl carrier protein reductase (Fa  ali model follow..  30  11.NLYFQSNAMQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVADALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKMKTEDFHHVIDNNLTSAFIGCREALKVMS-KSRFGSVVNVASIIG-------ERGNMGQTNYSASKGGMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNANLKDELKADYVKNIPLNRLGSAKEVAEAVAFLLSDHSSYITGETLKVNGGLYM. 265
12 -89.2003ctm_A mol:protein length:279 Carbonyl Reductase  ali model follow..  37  29........LFSLKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYN-SHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEETISQQEKDFGTIDVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHNIGKIFK-KNGKGSLIITSSISGKIVNIPQ------QAPYNTAKAACTHLAKSLAIEWAPFA-RVNTISPGYIDTDITDFASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYTC. 278
13 -89.1001edo_A mol:protein length:244 BETA-KETO ACYL CARRIER PROTEIN REDUCTASE  ali model follow..  31  1.............SPVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEEVSKQIEAYGGQAITFGGDVSKEADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMM-KKRKGRIINIASVVG-------LIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI. 244
14 -89.0004cql_A mol:protein length:261 ESTRADIOL 17-BETA-DEHYDROGENASE 8  ali model follow..  27  1...MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVG-------KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM. 261
15 -88.6003rih_A mol:protein length:293 short chain dehydrogenase or reductase  ali model follow..  28  23.EPAERKVMFDLSARSVLVTGGTKGIGRGIATVFARAGANVAVAARSPRELSSVTAELGELGAGNVIGVRLDVSDPGSCADAARTVVDAFGALDVVCANAGIFPEARLDTMTPEQLSEVLDVNVKGTVYTVQACLAPLT-ASGRGRVILTSSITGPVT------GYPGWSHYGASKAAQLGFMRTAAIELAPRGVTVNAILPGNILTEGLVDMGEEYISGMARSIPMGMLGSPVDIGHLAAFLATDEAGYITGQAIVVDGGQVL. 278
16 -88.3003woh_A mol:protein length:251 SiaM  ali model follow..  33  9...........LSGKVALVTGGSRGLGRAMALRLARDGAAVAIVYVSDDSSAKETQGEIERLGGTARSYRCDVSDAEQVTRCVKAVTADLGPVDILVNNAGIIRDGLAASIKDEDYDAVMNTNLKGAFLFIKACYFGFI-RKRSGSIINISSVSG-------VFGSAGQANYASAKAGLIGLTKSIAKELAERNVRCNAVAPGLIATDMTQDLVDDSK--RLDPVPMRRFGRPDEVAGLVAFLAGDESSYITGQVVCVDGGMAM. 251
17 -88.3004iiu_A mol:protein length:267 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  29  15........QSNAMSRSVLVTGASKGIGRAIARQLAADGFNIGVHYHRDAAGAQETLNAIVANGGNGRLLSFDVANREQCREVLEHEIAQHGAWYGVVSNAGIARDAAFPALSNDDWDAVIHTNLDSFYNVIQPCIMPMIGARQGGRIITLSSVSG-------VMGNRGQVNYSAAKAGIIGATKALAIELAKRKITVNCIAPGLIDTGMIEMEESALKE-AMSMIPMKRMGQAEEVAGLASYLMSDIAGYVTRQVISINGGML.. 261
18 -88.1004is2_A mol:protein length:268 Bile acid 3-alpha hydroxysteroid dehydrogenas  ali model follow..  27  7.ENLYFQGMNLVQDKVTIITGGTRGIGFAAAKIFIDNGAKVSIFGETQEEVDTALAQLKELYPEEVLGFAPDLTSRDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMK-DAKKGVIINTASVTG-------IFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPPEIMEGYLKALPMKRMLEPEEIANVYLFLASDLASGITATTVSVDGAY... 260
19 -88.0004nbw_A mol:protein length:257 Short-chain dehydrogenase/reductase SDR  ali model follow..  26  1.........MSTDKRVAIITGAANGIGRATALEFAQAGYHV-VAWDLAEEAGAALIAEIADAGGSADFARVDVSAAESVEAAVAEIIAEHGRVDVLVNNAGILHDGQLVKMAEAQFDAVISVNLKGVFLCTQAVAPHMI-AAKYGRILNASSVVG-------LYGNFGQTNYVAAKSGVIGMTKVWARELGRYGITVNAIAPGFIATEMVQQMPERVLEAMVARTPVGRIGDPVDIARAYLFLASEESGFISGTTLSVDGGMVV. 255
20 -87.9004nbu_A mol:protein length:250 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  30  5...........LQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFN-----EAAGKEAVEANPGVVFIRVDVSDRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAVLPYMA-EQGKGKIINTSSVTG-------TYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAPGFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGIMM. 244
21 -87.7002pd6_A mol:protein length:264 Estradiol 17-beta-dehydrogenase 8  ali model follow..  27  5...........LRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVG-------KVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM. 257
22 -87.6002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  31  1.......MEIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKYGVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMI-KQRWGRIVNISSVVG-------FTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVLSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGM... 247
23 -87.6001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  30  4..........DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKI-------PWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTLY 253
24 -87.5004iuy_A mol:protein length:274 Short chain dehydrogenase/reductase  ali model follow..  28  17.........FDVKDKYILITGASSGLGHHIAELFAKEGANIVICARRLERLKELESHIKNEYGVQVYTFALDVNDRSAVKDMLSSLEAEGVTIDVLINNAGVSDTKRFLDYNDEDWDKIVDTNLKAPWQCAQEVVQHMIKAERKGSIINITSILS-------QSTNLGVSPYCASKAGLRHLTEVMAVELARFGINVNAIAPGYMITEINEEYTSEVGQQLLKKIPTRKFVEFDDLNGPLLLLASQAGQGITGIEIKVDGGHSA. 265
25 -87.3001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  30  4..........DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEKI-------PWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKDPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQY 253
26 -87.3003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  33  1GSHMAG--IFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDV----MAAQAVVAGLENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTKGVIVNTASLAAKV-------GAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQERTPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRM. 262
27 -87.2004npc_A mol:protein length:265 Sorbitol dehydrogenase  ali model follow..  32  13........NFPLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDIS----ADIAKAKAEELGENAKPFVCDVSSQQSVNDAITAVISQFGKIDIAVNSAGVVYLAPAEDISLDYWDKTININLKGSFLVTQAVGRAMIAAGNGGKIINLASQAGTV-------AIEEHVAYCASKFGVIGMSKTFAAEWGKYGICVNTLSPTIVLTELGKKAAGEKGEAAKKRIPAGRFAYPEEIAAAAVFLASAGADMITGADLLIDGGYTI. 258
28 -87.0003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  30  6..........DLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMI-------PWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKDPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKY 255
29 -86.9001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  31  1.........MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAV------GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMR-EKNPGSIVLTASRVY--------LGNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKVPEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI. 240
30 -86.8004nbt_A mol:protein length:240 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  32  4...........LEGKVAVITGGAKGLGQAIALAYAEEGAKVIAGDLGD----------LTYSHPNVEGMYLNVTDVTGVEKFYQSVIDKYGKIDILVNNAGITKDAMTRKMTEAQWDAVIDVNLKGVFNLTRLVGPQMQ-TNGYGSIINISSVVG-------VFGNIGQANYAATKAGVIGLTMTWAKEFALKGVRVNAIAPGYIMTDILKTVPQDLLDKFAALTMLNRLGQPEEIAKVALFLASDDASYVTGQTINVNGGMRL. 240
31 -86.7003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  25  1.......MAMVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGCGPNSPRRVKWLEDQKALGFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMV-ERGWGRIINISSVNGQ-------KGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAIRPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM. 249
32 -86.6003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  27  2...........EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLME-KNGGGHIVSISSLGS-------IRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPEDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL. 248
33 -86.5003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  22  1.......MSLGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKETYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMR-KQNFGRIINYG-----FQGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEATIQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV. 253
34 -86.2004nbr_A mol:protein length:273 Hypothetical 3-oxoacyl-(Acyl-carrier protein)  ali model follow..  28  16........RPSHKERNVLITGAARGIGRAIAQAFVERSATVGICDLNLADVARTCEELNGLGLGRAVPIACDVSDYDALVAAID---DTGLVFDTVVNNAGISPKHKVWEMAPDEWRRVVDVNLTGTFNTIRALTPGMV-EARRGWIVNTSSVAGKTYS------PIVACHYAATKSAIIGFTKHLAAELGPYSIRVNAMAPGRIATPMVAGVAPEVNAEQVKLTPMARLGQPAEVADVALWLTSTESSFVTGQTVDVAGGLYM. 266
35 -86.2003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  28  1..SMSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDL-KSEGAEAVAAAIRQAGGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPKP-FDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQ-KAGGGAILNISSMAG-------ENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQ. 253
36 -86.1003vzp_A mol:protein length:257 Acetoacetyl-CoA reductase  ali model follow..  27  3........GSGSTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMA-DRGWGRIVNISSVNGQ-------KGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM. 250
37 -86.0001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  26  1.........MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADIN----LEAARATAAEIGPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGRGGKIINMASQAGR-------RGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWM. 255
38 -85.9003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  27  1.........MSLNEKVALVTGASRGIGFEVAHALASKGATV-VGTATSQASAEKFENSMKEKGFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMM-KKRWGRIISIGSVVG-------SAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKLTDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM. 246
39 -85.8003afm_A mol:protein length:258 Carbonyl reductase  ali model follow..  27  4..........DLKGKRVLITGSSQGIGLATARLFARAGAKVGLHGRKAPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAASGQTSAVISTGSIAGHT------GGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHASGYITGQVLDINGGQYK. 257
40 -85.7004w7h_A mol:protein length:258 Carbonyl reductase  ali model follow..  26  4..........DLKGKRVLITGSTEGIGLATARLFARAGAKVGLNSHVDPANIDETIASMRADGGDAAFFAADLATSEACQQLVDEFVAKFGGIDVLINNAGLVGRKPLPEIDDTFYDAVMDANIRSVVMTTKFALPHLAASGQTSAVISTGSIAGHT------GGGPGAGLYGAAKAFLHNVHKNWVDFHTKDGVRFNIVSPGTVDTAFHADKTQDVRDRISNGIPMGRFGTAEEMAPAFLFFASHASGYITGQVLDINGGQYK. 257
41 -85.6003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  25  1........TERLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINA----EGAKAAAASIGKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGKAGRVISIASNTF-------FAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKASPHNEAFGFVEMLAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVR. 246
42 -85.6004m8s_A mol:protein length:248 Putative 3-oxoacyl-[acyl-carrier protein] red  ali model follow..  28  3........TQDLSGKIALVTGASRGIGAAIADTLAAAGAKV-IGTATSESGAAAISERLAQWGGE--GRVLNSAEPETVENLIADIEKTFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFRASKAVLRGMM-KQRAGRIINITSVVG-------VMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITVNCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLHVNGGMLM. 247
43 -85.5001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  29  1...MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDI-NADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKP-FDMPMADFRRAYELNVFSFFHLSQLVAPEME-KNGGGVILTITSMAA-------ENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQ. 252
44 -85.4004egf_A mol:protein length:266 L-xylulose reductase  ali model follow..  26  15........VLRLDGKRALITGATKGIGADIARAFAAAGARLVLSGRDVSELDAARRALGEQFGTDVHTVAIDLAEPDAPAELARRAAEAFGGLDVLVNNAGISHPQPVVDTDPQLFDATIAVNLRAPALLASAVGKAMVAAGEGGAIITVASAAALA-------PLPDHYAYCTSKAGLVMATKVLARELGPHGIRANSVCPTVVLTEMGQRVDEAKSAPMIARIPLGRFAVPHEVSDAVVWLASDAASMINGVDIPVDGGYTM. 265
45 -85.4002ph3_A mol:protein length:245 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  29  2..............RKALITGASRGIGRAIALRLAEDGFALAIHYGQNREKAEEVAEEARRRGSPLVALGANLLEAEAATALVHQAAEVLGGLDTLVNNAGITRDTLLVRMKDEDWEAVLEANLSAVFRTTREAVKLMM-KARFGRIVNITSVVG-------ILGNPGQANYVASKAGLIGFTRAVAKEYAQRGITVNAVAPGFIETEMTERLPQEVKEAYLKQIPAGRFGRPEEVAEAVAFLVSEKAGYITGQTLCVDGGLTP. 244
46 -85.1004k6c_A mol:protein length:255 Acetoacetyl-CoA reductase  ali model follow..  30  1.........MAMTKRIAVVTGGMGGLGEAVSIRLNDAGHRVVVTYSPNNTGADRWLTEMHAAGREFHAYPVDVADHDSCQQCIEKIVRDVGPVDILVNNAGITRDMTLRKLDKVNWDAVIRTNLDSVFNMTKPVCDGMV-ERGWGRIVNISSVNGS-------KGSVGQTNYAAAKAGMHGFTKSLALEIARKGVTVNTVSPGYLATKMVTAIPQDILDKILPQIPAGRLGKPEEVAALVAYLCSEEAGFVTGSNIAINGGQHMH 249
47 -85.1004n5l_A mol:protein length:270 Acetoacetyl-CoA reductase  ali model follow..  27  16........QGAMTQRIAYVTGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQKALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMA-DRGWGRIVNISSVNGQ-------KGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDKIVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGGLHM. 263
48 -85.1002c07_A mol:protein length:285 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE  ali model follow..  29  28.......YYYCGENKVALVTGAGRGIGREIAKMLAKSVSHV-ICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMI-NNRYGRIINISSIVG-------LTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS.. 274
49 -85.1004nim_A mol:protein length:277 Versicolorin reductase  ali model follow..  24  6..........QLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVEGAIVNVSSMSS-------MGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMASDGEDRIPANWLEEAVKTQPFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWG. 259
50 -85.1004rzi_B mol:protein length:240 3-ketoacyl-acyl carrier protein reductase  ali model follow..  32  3........SLGLEDKVIVVTGGNRGIGAAIVKLLQEMGAKVAFTDLATDGG-----------NTEALGVVANVTDLESMTAAAAEITDKLGPVYGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMY-ERKAGSIVAISSISG-------ERGNVGQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEMTLAIREDIREKITKEIPFRRFGKPEEIAWAVAFLLSPASSYVTGEVLRVNGAH... 238
51 -85.0003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  27  2.....PGSMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTRE----EKLKELAAELGERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMM-RRRNGRIINITSIVG-------VTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKLNEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM. 248
52 -84.7005epo_A mol:protein length:262 7-alpha-hydroxysteroid deydrogenase  ali model follow..  27  3..........RLEGKVAIVTSSTRGIGRASAEALAKEGALVYLAAR-SEELANEVIADIKKQGGVAKFVYFNAREEETYTSMVEKVAEAEGRIDILVNNYGGTNVNLLTAGDTDEFFRILKDNVQSVYLPAKAAIPHME-KVGGGSIVNISTIGS-------VVPDISRIAYCVSKSAINSLTQNIALQYARKNIRCNAVLPGLIGTRAAENMTDEFRDSFLGHVPLNRVGRPEDIANAVLYYASDDSGYVTGMIHEVAGGFAL. 251
53 -84.7004rzh_A mol:protein length:247 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  34  3..........ALTAQVALVTGASRGIGKATALALAATGMKVVVNYAQSSTAADAVVAEIIANGGEAIAVQANVANADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLML-KQKSGRIINITSVAG-------MMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNAE---PILQFIPLARYGQPEEVAGTIRFLATDAAAYITGQTFNVDGGMVM. 246
54 -84.5004afn_A mol:protein length:269 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FA  ali model follow..  28  9.TENLYFQSMSLQGKVALVTGASRGIGQAIALELGRLGAVV-IGTATSASGAEKIAETLKANGVEGAGLVLDVSSDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMT-KARWGRIINIGSVVG-------AMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTRELPEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMYM. 262
55 -84.4003qiv_A mol:protein length:253 short-chain dehydrogenase or 3-oxoacyl-[acyl-  ali model follow..  31  4........SMRFENKVGIVTGSGGGIGQAYAEALAREGAAVVVADI-NAEAAEAVAKQIVADGGTAISVAVDVSDPESAKAMADRTLAEFGGIDYLVNNAAIMKLDFLLTIDPEYYKKFMSVNLDGALWCTRAVYKKMT-KRGGGAIVNQSSTAA----------WLYSNYYGLAKVGINGLTQQLSRELGGRNIRINAIAPGPIDTEANTTTPKEMVDDIVKGLPLSRMGTPDDLVGMCLFLLSDEASWITGQIFNVDGGQII. 251
56 -84.4004o0l_A mol:protein length:275 NADPH-dependent 3-quinuclidinone reductase  ali model follow..  34  26........MFSMKGKVTAITGGGGGIGFAAAEAIAEAGGDVALLYRSAPNMEERSAELAKRFGVKVKSYQCEVTEHESVKQAIEAVEKDFGRLDCYIANAGGGPGSINPDYPLEAWHKTQSVNLHSTFYAARECARIFK-AQGSGSFIATTSISARIVNVPY-----DQPAYNSSKAAVVHFCRSLARDWRN-FARVNTISPGFFDTPMGPS-DKAVEDVLYQKSVLGRAGDVKELKAAYLYLASNASTYTTGADLLIDGGYCL. 274
57 -84.3004w7i_A mol:protein length:258 4-deoxy-L-erythro-5-hexoseulose uronate reduc  ali model follow..  22  4..........DLKGKRILITGSSQGIGMATAIELARYGAVVGLHGRKAPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASATTSAVISTGSIAAREGG------GIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHASGYITGQILDVNGGQIC. 257
58 -84.2004e6p_A mol:protein length:259 Probable sorbitol dehydrogenase (L-iditol 2-d  ali model follow..  26  5..........RLEGKSALITGSARGIGRAFAEAYVREGATVAIADID----IERARQAAAEIGPAAYAVQMDVTRQDSIDAAIAATVEHAGGLDILVNNAALFDLAPIVEITRESYEKLFAINVAGTLFTLQAAARQMIAQGRGGKIINMASQAGR-------RGEALVAIYCATKAAVISLTQSAGLDLIKHRINVNAIAPGVVDGEHWDGVDAEKKRLVGEAVPFGRMGTAEDLTGMAIFLASAESDYIVSQTYNVDGGNWM. 258
59 -84.1003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  28  17........DKTLDKQVAIVTGASRGIGRAIALELARRGAMV-IGTATTEAGAEGIGAAFKQAGLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMM-KARGGRIVNITSVVG-------SAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGLPQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFM. 263
60 -84.1004tkl_A mol:protein length:258 NADH-dependent reductase for 4-deoxy-L-erythr  ali model follow..  21  4..........DLKGKRILITGSTEGIGMATAIELARYGAVVGLNSHVDPADPALLLGKLREAGGDGAFFRADITKTAECQRLVSAFVERFDGIDVLINNAGLAGRSNLENIDDAFYDRVMDLNGRSVLMMTKFAIPHLRASATTSAVISTGSIAAREGG------GIGAGVYAASKAWLHDIHRNWVKEFTKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHASGYITGQILDVNGGQIC. 257
61 -84.0003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  25  20...........LKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGLGRVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDHGGVIVNNASVLG-------WRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTSSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.. 266
62 -83.8003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  25  12....GPGSMFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTRE----DKLKEIAADLGKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMM-RRRYGRIINITSIVG-------VVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKLNEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM. 259
63 -83.8002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  26  3..........LFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAE-------AIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMR-KVGGGAIVNVASVQG-------LFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTA. 247
64 -83.7003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  28  14........GSMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLMHERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMV-ERRFGRIVNIGSVNGS-------RGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAVPQDVLEKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHM. 262
65 -83.6004dml_A mol:protein length:269 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  33  10.PRGSHMTALPLTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKADVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCSRAAAKIML-KQRSGRIINIASVVG-------EMGNPGQANYSAAKAGVIGLTKTVAKELASRGITVNAVAPGFIATDMTSELAAE---KLLEVIPLGRYGEAAEVAGVVRFLAADAAAYITGQVINIDGGLVM. 262
66 -83.5001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  31  1.......MSKKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDM-NREALEKAEASVREKGVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMI-TQNYGRIVNTASMAG-------VKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG.... 262
67 -83.5003f9i_A mol:protein length:249 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  28  3........MIDLTGKTSLITGASSGIGSAIARLLHKLGSKVIISGSNE----EKLKSLGNALKDNYTIEVCNLANKEECSNLIS----KTSNLDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMI-QKRYGRIINISSIVG-------IAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM. 242
68 -83.4002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  30  3..........RLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREE----RLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVL---EEGGSLVLTGSVAG--------LGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI. 241
69 -83.2004yqy_A mol:protein length:270 Putative Dehydrogenase  ali model follow..  29  8GTENLYFQSMDLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTE---GSSIVGLASQAGRDG------GGPGASAYGASKGALMTLTRGLAKELGPK-IRVNSLCPGMIDTDFHNIFKPEVRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLF. 263
70 -83.2005cdy_A mol:protein length:244 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  28  1.........MSFEGKIALVTGASRGIGRAIAELLVERGACVI----GTATSEKGAEAISAYLGENGKGLMLNVVDPTSIDTVLATIRAEFGEVDILVNNAGITRDNLLMRMKDDEWQDIIDTNLTSVFRLSKAVMRAMM-KKRFGRIITIGSVVG-------TMGNAGQVNYAAAKAGVIGFSKSLAREVASRGITVNVVAPGFIETDMTRTLTDDQRAGILAQVPANRLGDAKEIASAVAFLASDEASYISGETLHVNGGMYM. 243
71 -83.2001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  28  1.........MNFEGKIALVTGASRGIGRAIAETLAARGAKVI----GTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMM-KKRHGRIITIGSVVG-------TMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM. 243
72 -83.2005er6_A mol:protein length:251 Oxidoreductase, short chain dehydrogenase/red  ali model follow..  26  5...........LKEKLVLVTGAGRGLGAAISSGAAEQGARVILVDI-DGTAAKAQADALTAKGFVAEGHALDVTDRDAVAALADDILSRFGGLDVLVNNAGVARAAFDQPEAVEVWDRVIGVNLEGAFNVSHALVPAL--KAAKGNVVHLCSVAG-------FVSGGSTAGYVVSKGAIRSLTQVMARDLAPHGIRVNAVAPGIMMSEMAVAQRPGGTDWFMNRVMMKRIGETSEVVDPVVFLASPMASYITGTILPVDGGFLA. 250
73 -83.0003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  26  7........FMNLEGKVALVTGASRGIGKAIAELLAERGAKVI----GTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMM-KKRQGRIINVGSVVG-------TMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM. 250
74 -82.9003edm_A mol:protein length:259 Short chain dehydrogenase  ali model follow..  31  3........LQRFTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVAEIEKLGRSALAIKADLTNAAEVEAAISAAADKFGEIHGLVHVAGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAK---GGAIVTFSSQAGRD------GGGPGALAYATSKGAVMTFTRGLAKEVGPK-IRVNAVCPGMISTTFHDTFKPEVRERVAGATSLKREGSSEDVAGLVAFLASDDAAYVTGACYDINGGVLF. 250
75 -82.8004cr6_A mol:protein length:271 N-ACYLMANNOSAMINE 1-DEHYDROGENASE  ali model follow..  24  6....VSRRPGRLAGKAAIVTGAAGGIGRATVEAYLREGASVVAMDLAPRLAATRYE------EPGAIPIACDLADRAAIDAAMADAVARLGGLDILVAGGALKGGGNFLDLSDADWDRYVDVNMTGTFLTCRAGARAMVAAGRSARIITIGSVNSFM-------AEPEAAAYVAAKGGVAMLTRAMAVDLARHGILVNMIAPGPVDVTGNNTGEPRLAEQVLDEVALGRPGLPEEVATAAVFLAEDGSSFITGSTITIDGGLSA. 260

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.