current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCEHADLLALast
1 -27.5001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model  100  1NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCEHADLLA 49
2 -26.0001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  61  1NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKW 49
3 -25.8001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  57  3SHFNDCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKW 51
4 -24.4001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  88  2....GAPSSYDGYCLNGGVAMHIESLDSYTCNCVIGYSGDRCQTRDL.. 44
5 -24.0001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  93  1NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDL.. 47
6 -23.1003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  28  3SHLVKCAEKEKTFCVNGGECFMVKDLSNYLCKCPNEFTGDRCQNYVMAS 54
7 -22.6001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  43  3SHFNDCPDSHTQFCFHGT-CRFLVQEDKPACVCHSGYVGARCEHADLLA 50
8 -21.6001iox_A mol:protein length:50 Betacellulin  ali model follow..  36  3GHFSRCPKQYKHYCIKGR-CRFVVAEQTPSCVCDEGYIGARCERVDL.. 48
9 -21.0001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  28  3SHLVKCAEKEKTFCVNGGECFMVKDLSNYLCKCQPGFTGARCTENVPMK 54
10 -20.6005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  41  30VSITKCSSDMNGYCLHGQ-CIYLVDMSQNYCRCEVGYTGVRCEHFFL.. 75
11 -20.1002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  31  7GKKNPCNAEFQNFCIHGE-CKYIEHLEAVTCKCQQEYFGERCGEK.... 50
12 -19.9001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  28  35KKRDPCLRKYKDFCIHG-ECKYVKELRAPSCICHPGYHGERCHGLS... 79
13 -16.8003ltf_D mol:protein length:58 Protein spitz  ali model follow..  34  9......ETFDAWYCLNDAHCFAVKIADVYSCECAIGFMGQRCEYKEIDN 53
14 -16.6001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  28  44.HSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKSCE...... 85
15 -16.3001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  34  42SKYKDGDQCEGHPCLNQGHCK--DGIGDYTCTCAEGFEGKNCE...... 82
16 -15.9004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  35  2.DIVDGDQCESNPCLNGGSC--KDDINSYECWCPFGFEGKNCE...... 41
17 -15.1001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  34  1...SDGDQCASSPCQNGGSC--KDQLQSYICFCLPAFEGRNCE...... 38
18 -14.8004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  34  46......QACRTNPCLHGGRC--LEVEGHRLCHCPVGYTGPFCD...... 80
19 -14.8001fax_L mol:protein length:96 FACTOR XA  ali model follow..  35  1..YKDGDQCETSPCQNQGKCK--DGLGEYTCTCLEGFEGKNCE...... 39
20 -14.4001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  38  2......ASCQDMSCSKQGEC--LETIGNYTCSCYPGFYGPECEY..... 37
21 -14.1001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  36  43KQYVDGDQCEPNPCLNGGLCK--DDINSYECWCQVGFEGKNCE...... 83
22 -14.0003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  25  180GCEGPSTTCQEDSCSNQGVC--LQQWDGFSCDCSTSFSGPLCNDP.... 223
23 -13.8001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  35  37NKYKDGDQCETSPCQNQGKCK--DGLGEYTCTCLEGFEGKNCEL..... 78
24 -13.4001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  36  48......DQCETSPCQNQGKCK--DGLGEYTCTCLEGFEGKNCEL..... 83
25 -13.4001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  36  42ISYSDGDQCASSPCQNGGSCK--DQLQSYICFCLPAFEGRNCE...... 82
26 -13.3004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  11  245.......VELYITSGDNGNT--FHGSMTYSGEGPIGFRAMALPQ..... 279
27 -13.3004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  27  1......DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS...... 37
28 -13.2002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  38  152..........PGGCRNGGFC-----NERRICECPDGFHGPHCEGTK... 182
29 -12.5004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  24  75YCEINTDECASSPCLHNGRC--VDKINEFLCQCPKGFSGHLCQ...... 115
30 -12.5001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  26  13....PLEHPCASLCCGHGTC--IDGIGSFSCDCRSGWEGRFCQR..... 50
31 -12.1005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  26  116NCEENIDDCPGNNCKNGGAC--VDGVNTYNCRCPPEWTGQYCTE..... 157
32 -12.0004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  21  169........NVDAKSNDGGKT--LSGTMTYNGEGPIGFRGTLTS...... 201
33 -11.9005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  26  113NCEENIDDCPGNNCKNGGAC--VDGVNTYNCRCPPEWTGQYCTE..... 154
34 -11.8002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  21  78HCEVNTDECASSPCLHNGRC--LDKINEFQCECPTGFTGHLCQ...... 118
35 -11.0003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  37  191......EEGEGGVCLNGGVC--SVVDDQAVCDCSTGFRGKDCSQ..... 227
36 -11.0003cfw_A mol:protein length:164 L-selectin  ali model follow..  34  120......ASCQPWSCSGHGEC--VEIINNYTCNCDVGYYGPQCQFVQVDP 160
37 -10.9004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  48  272..........HQPCLNGGTCSN-TGPDKYQCSCPEGYSGPNCEIVD... 306
38 -10.9005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  32  2......NPCCSHPCQNRGVCM--VGFDQYKCDCTTGFYGENCSTPEFLT 44
39 -10.8004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  28  194....DQPICLSGCHEQNGYC-----SKPDECNCRPGWQGPLCNE..... 228
40 -10.8004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  26  419HCDDNVDDCASSPCANGGTC--RDGVNDFSCTCPPGYTGRNCS...... 459
41 -10.8004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  25  223...PLCNECIPHKGCRHGTC-----TIPWQCACDEGWGGLFCD...... 257
42 -10.3003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  40  6......SPCISQPCLHNGSCQ--DSIWGYTCTCSPGYEGSNCE...... 40
43 -9.8501u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  30  34......NPCCYYPCQHQGICVR-FGLDRYQCDCTTGYSGPNCTIPEIWT 76
44 -9.7203ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  48  451.............CRHGGVC-----VRPNKCLCKKGYLGPQCE...... 475
45 -9.6502vj2_A mol:protein length:169 JAGGED-1  ali model follow..  50  131..........HQPCLNGGTCSN-TGPDKYQCSCPEGYSGPNCE...... 162
46 -9.1802m74_A mol:protein length:136 Fibrillin-1  ali model follow..  42  109..........ESGCLNGGRC-----VAPNRCACTYGFTGPQCE...... 136
47 -9.0102pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  21  331NVTSGALLCSQALCSGHGRCVQAQMAVEFKCRCYPGWQAPWCERKS... 414

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.