current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
2 -25.0001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  69  1NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR 53
3 -24.4001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  65  3SHFNDCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWEL. 54
4 -24.0001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  93  1NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCEHADL...... 47
5 -22.4001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  26  3SHLVKCAEKEKTFCVNGGECFMVKDLSNYLCKCQPGFTGARCTENVPMKVQNQ 58
6 -21.9001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  95  2....GAPSSYDGYCLNGGVAMHIESLDSYTCNCVIGYSGDRCQTRDLR..... 45
7 -20.3003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  30  3SHLVKCAEKEKTFCVNGGECFMVKDLSNYLCKCPNEFTGDRCQNYVMASF... 55
8 -19.2005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  36  30VSITKCSSDMNGYCLHGQ-CIYLVDMSQNYCRCEVGYTGVRCEHFFL...... 75
10 -18.7001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  34  3SHFNDCPDSHTQFCFHGT-CRFLVQEDKPACVCHSGYVGARCEHADL...... 48
11 -18.6001iox_A mol:protein length:50 Betacellulin  ali model follow..  34  3GHFSRCPKQYKHYCIK-GRCRFVVAEQTPSCVCDEGYIGARCERVDLF..... 49
12 -18.0002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  31  7GKKNPCNAEFQNFCIH-GECKYIEHLEAVTCKCQQEYFGERCGEK........ 50
13 -17.6001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  29  42SKYKDGDQCEGHPCLNQGHCK--DGIGDYTCTCAEGFEGKNCEFST....... 85
14 -17.6001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  23  43CHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKSCEIDT....... 88
15 -17.1003ltf_D mol:protein length:58 Protein spitz  ali model follow..  32  9......ETFDAWYCLNDAHCFAVKIADVYSCECAIGFMGQRCEYKEIDNTYL. 56
16 -16.5001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  28  1...SDGDQCASSPCQNGGSC--KDQLQSYICFCLPAFEGRNCETHKDDGSA.. 46
17 -15.9003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  21  180GCEGPSTTCQEDSCSNQGVC--LQQWDGFSCDCSTSFSGPLCNDPGTTYIFSK 231
18 -15.8001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  28  43KQYVDGDQCEPNPCLNGGLCK--DDINSYECWCQVGFEGKNCELDATCNIKN. 92
19 -15.8004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  32  2.DIVDGDQCESNPCLNGGSC--KDDINSYECWCPFGFEGKNCE.......... 41
20 -15.7001fax_L mol:protein length:96 FACTOR XA  ali model follow..  27  2...KDGDQCETSPCQNQGKCK--DGLGEYTCTCLEGFEGKNCELFTRK..... 44
21 -15.6004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  28  42..RLASQACRTNPCLHGGRC--LEVEGHRLCHCPVGYTGPFCDVDT....... 83
23 -15.3004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  24  75YCEINTDECASSPCLHNGRC--VDKINEFLCQCPKGFSGHLCQSGRLEVLFQ. 124
24 -15.1001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  30  42ISYSDGDQCASSPCQNGGSCK--DQLQSYICFCLPAFEGRNCETHKDDQLI.. 90
25 -14.8001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  28  48......DQCETSPCQNQGKCK--DGLGEYTCTCLEGFEGKNCELFTRKLCSLD 92
26 -14.4004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  22  1......DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASD.. 45
27 -14.1001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  34  2......ASCQDMSCSKQGEC--LETIGNYTCSCYPGFYGPECEYVR....... 39
29 -13.9002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  36  152..........PGGCRNGGFC-----NERRICECPDGFHGPHCEGT........ 181
30 -13.8004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  11  245.......VELYITSGDNGNT--FHGSMTYSGEGPIGFRAMALPQ......... 279
32 -13.6004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  16  146........GSAAPWHSGGVWVLLSGTMTYNGEGPIGFRGTLTSPDTYTVEN.. 209
33 -13.2001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  26  11..VLPLEHPCASLCCGHGTC--IDGIGSFSCDCRSGWEGRFCQREV....... 52
34 -12.9004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  24  419HCDDNVDDCASSPCANGGTC--RDGVNDFSCTCPPGYTGRNCSAPVSRCEH.. 467
36 -12.3003r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  36  191......EEGEGGVCLNGGVC--SVVDDQAVCDCSTGFRGKDCSQG........ 228
37 -11.9005f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  36  2......NPCCSHPCQNRGVCMS-VGFDQYKCDCTTGFYGENCST......... 39
38 -11.9003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  31  6......SPCISQPCLHNGSCQ--DSIWGYTCTCSPGYEGSNCELAKNECHPER 50
39 -11.5004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  34  261LCDKDLNYCTHQPCLNGGTCSN-TGPDKYQCSCPEGYSGPNCEIVD....... 306
40 -11.5004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  27  194....DQPICLSGCHEQNGYC-----SKPDECNCRPGWQGPLCNEAA....... 230
41 -11.4004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  23  223...PLCNECIPHKGCRHGTC-----TIPWQCACDEGWGGLFCDQAA....... 260
42 -11.3003cfw_A mol:protein length:164 L-selectin  ali model follow..  39  120......ASCQPWSCSGHGEC--VEIINNYTCNCDVGYYGPQCQFVQ....... 157
43 -11.2001u67_A mol:protein length:600 Prostaglandin G/H synthase 1 precursor  ali model follow..  34  34......NPCCYYPCQHQGICVR-FGLDRYQCDCTTGYSGPNCTI......... 71
44 -10.9002pe4_A mol:protein length:424 Hyaluronidase-1  ali model follow..  22  331NVTSGALLCSQALCSGHGRCVRRTSAVEFKCRCYPGWQAPWCERK........ 413
45 -10.7002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  15  88...LYCDKCIPHPGCVHGIC-----NEPWQCLCETNWGGQLCDKDLNYCGTHQ 132
46 -10.4003ho3_A mol:protein length:481 Hedgehog-interacting protein  ali model follow..  44  451.............CRHGGVC-----VRPNKCLCKKGYLGPQCE.......... 475
47 -9.5402m74_A mol:protein length:136 Fibrillin-1  ali model follow..  39  109..........ESGCLNGGRC-----VAPNRCACTYGFTGPQCE.......... 136
48 -9.4005e6v_A mol:protein length:224 Integrin beta-2  ali model follow..  24  185ECRCRDQSRDRSLCHGKGFLE--------ICRCDTGYIGKNCE.......... 221
49 -9.2203s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  22  572......QEYRQHPCQDNGGCSHIKGDGTTRCSCPMHLVELSC........... 615
50 -9.0404z80_A mol:protein length:508 EGF family domain-containing protein  ali model follow..  21  463IAVLPEDKCVSVDCGAHGTC----DVATGKCVCEPGFTGERCDAAA....... 504

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.