current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 1a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
2 -25.5001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  63  7.DCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLK 50
3 -25.3001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  63  5.ECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLK 48
4 -24.4001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  88  5.GCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCEHADL. 47
5 -22.2001iox_A mol:protein length:50 Betacellulin  ali model follow..  33  8..CPKQYKHYCIKGR-CRFVVAEQTPSCVCDEGYIGARCERVDLF 49
6 -22.0001mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  34  8..CPDSHTQFCFHGT-CRFLVQEDKPACVCHSGYVGARCEHADL. 48
7 -21.9001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  95  5.GCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLR 48
8 -21.9003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  30  8..CAEKEKTFCVNGGECFMVKDLSNYLCKCPNEFTGDRCQNYVMA 53
9 -20.8002rnl_A mol:protein length:50 Amphiregulin  ali model follow..  30  12..CNAEFQNFCIHGE-CKYIEHLEAVTCKCQQEYFGERCGEK... 50
10 -20.4005e8d_A mol:protein length:75 Proepiregulin  ali model follow..  33  34.KCSSDMNGYCLHGQ-CIYLVDMSQNYCRCEVGYTGVRCEHFFL. 75
11 -19.7001xdt_R mol:protein length:79 HEPARIN-BINDING EPIDERMAL GROWTH FACTOR  ali model follow..  26  39.PCLRKYKDFCIH-GECKYVKELRAPSCICHPGYHGERCHGLS.. 79
12 -18.7001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  27  7.KCAEKEKTFCVNGGECFMVKDLSNYLCKCQPGFTGARCTENVPM 53
13 -16.0003ltf_D mol:protein length:58 Protein spitz  ali model follow..  30  9...ETFDAWYCLNDAHCFAVKIADVYSCECAIGFMGQRCEYKEID 52
14 -14.2001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  25  47.PVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKSCE..... 85
15 -13.9004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  30  5.DGDQCESNPCLNGGSC--KDDINSYECWCPFGFEGKNCELLE.. 44
16 -13.8001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  29  2.DGDQCASSPCQNGGSC--KDQLQSYICFCLPAFEGRNCE..... 38
17 -13.5001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  29  46.DGDQCEGHPCLNQGHCK--DGIGDYTCTCAEGFEGKNCE..... 82
18 -13.3001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  33  2...ASCQDMSCSKQGEC--LETIGNYTCSCYPGFYGPECEY.... 37
19 -12.8004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  31  46...QACRTNPCLHGGRC--LEVEGHRLCHCPVGYTGPFCD..... 80
20 -12.7001fax_L mol:protein length:96 FACTOR XA  ali model follow..  29  3.DGDQCETSPCQNQGKC--KDGLGEYTCTCLEGFEGKNCE..... 39
21 -11.8002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  32  152.......PGGCRNGGFC-----NERRICECPDGFHGPHCEGTK.. 182
22 -11.6001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  32  47.DGDQCEPNPCLNGGLCK--DDINSYECWCQVGFEGKNCE..... 83
23 -11.6003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  25  185..STTCQEDSCSNQGVC--LQQWDGFSCDCSTSFSGPLCNDP... 223
24 -11.4001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  29  41.DGDQCETSPCQNQGKC--KDGLGEYTCTCLEGFEGKNCE..... 77
25 -11.4004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  24  1...DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS..... 37
26 -11.4001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  28  45KDGDQCETSPCQNQGKCK--DGLGEYTCTCLEGFEGKNCE..... 82
27 -11.4004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  11  245....VELYITSGDNGNT--FHGSMTYSGEGPIGFRAMALPQ.... 279
28 -11.0001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  29  46.DGDQCASSPCQNGGSCK--DQLQSYICFCLPAFEGRNCE..... 82
29 -10.8001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  27  15...EHPCASLCCGHGTC--IDGIGSFSCDCRSGWEGRFCQR.... 50
30 -10.5004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  22  171.......DAKSNDGGKT--LSGTMTYNGEGPIGFRGTLTS..... 201
31 -9.9704xlw_B mol:protein length:261 Delta-like protein  ali model follow..  20  223PLCNECIPHKGCRHGTC-----TIPWQCACDEGWGGLFCD..... 257
32 -9.9205fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  29  3.QADPCASNPCANGGQC--LPFEASYICHCPPSFHGPTCR..... 39
33 -9.8804xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  27  79.NTDECASSPCLHNGRC--VDKINEFLCQCPKGFSGHLCQ..... 115
34 -9.8004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  42  272.......HQPCLNGGTCS--TGPDKYQCSCPEGYSGPNCEIVD.. 306
35 -9.5603cfw_A mol:protein length:164 L-selectin  ali model follow..  37  120...ASCQPWSCSGHGEC--VEIINNYTCNCDVGYYGPQCQFV... 156
36 -9.4403r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  34  191...EEGEGGVCLNGGVC--SVVDDQAVCDCSTGFRGKDCSQG... 228
37 -9.3704xl1_B mol:protein length:230 Delta-like protein  ali model follow..  21  191KYCDQCLSGCHEQNGYC-----SKPDECNCRPGWQGPLCN..... 227
38 -9.2102vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  24  82.NTDECASSPCLHNGRC--LDKINEFQCECPTGFTGHLCQ..... 118
39 -9.1805fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  23  117.NIDDCPGNNCKNGGAC--VDGVNTYNCRCPPEWTGQYCTE.... 154

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.