current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 2m74_A mol:protein length:136 Fibrillin-1, from PDB0516

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst SARGGGGHDALKGPNVCGSRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCNIRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCELast
1 -23.800sp|Q96CC6|RHDF1_HUMAN Inactive rhomboid protein 1 OS=Homo sapiens GN=RHBDF1 PE=1 SV=2 (Range: 368-649)  ali follow..  129EKHSACCVRNDRSGCVQTSEEECSSTLAVWVKWPIHPSAPELAGHKRQFGSVCHQDPRVCDEPSSEDPHE------WPEDITKWPICTKNSAGNHTNHPHMDCVITGRPCCIGTKGRCESREYCDFMRGYFHEEAT 260
2 -12.300sp|Q96K78|GP128_HUMAN Probable G-protein coupled receptor 128 OS=Homo sapiens GN=GPR128 PE=1 SV=2 (Range: 35-94)  ali follow..  20  6....................................................................KSTSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFNSTYMGFTFARIP............... 60
3 -6.580sp|Q9NQ30|ESM1_HUMAN Endothelial cell-specific molecule 1 OS=Homo sapiens GN=ESM1 PE=2 SV=2 (Range: 91-143)  ali follow..  20  12.............................................................................................CPYGTFGMDCRET---CNCQSGICDRGTGKCLKFPFFQYSVTK 51
4 -6.470sp|O14525|ASTN1_HUMAN Astrotactin-1 OS=Homo sapiens GN=ASTN1 PE=1 SV=3 (Range: 411-608)  ali follow..  20  44...........................................................SSGPWAMDLCARRLLDPCEHQCDPETHRAAGECLCYEGYMKDPVHKHLC............................ 96
5 -6.210sp|O75129|ASTN2_HUMAN Astrotactin-2 OS=Homo sapiens GN=ASTN2 PE=2 SV=2 (Range: 453-651)  ali follow..  24  53...........................................................ATSPWVRDLCGQRTTDACEQLCDP----ETGECSCHEGYAPDPVHRHLC............................ 97
6 -6.120sp|A4D0V7|CG058_HUMAN Uncharacterized protein C7orf58 OS=Homo sapiens GN=C7orf58 PE=2 SV=1 (Range: 69-215)  ali follow..  12  87................................................................................CLSSKKAEGTPCISKEVMCQLGLHQKANRLPEIQQPLCRKEGLCQIVRRFPELQ.. 140
7 -5.750sp|Q3V5L5|MGT5B_HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B OS=Homo sapiens GN=MGAT5B PE=2 SV=2 (Range: 236-792)  ali follow..  16  461..PGRACTDTCLDHGL-------ICEPSFFPF---NSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPL-LFSCAGSNTKYRRLCPCRDFRKGQVA--------CQG---CL................. 557
8 -5.730sp|Q685J3|MUC17_HUMAN Mucin-17 OS=Homo sapiens GN=MUC17 PE=1 SV=2 (Range: 4293-4391)  ali follow..  25  49....................................................................................................SPCEPGFSVSKNCNLGKCQSGPQCLCVTTYSGETCN 91
9 -5.720sp|Q02505|MUC3A_HUMAN Mucin-3A OS=Homo sapiens GN=MUC3A PE=2 SV=2 (Range: 2355-2445)  ali follow..  36  41....................................................................................................TKCTSGVDNAIDCHQGQCVSGPACRCYSTFSGPRCE 83
10 -5.590tr|Q6YL35|Q6YL35_HUMAN Uncharacterized protein OS=Homo sapiens PE=2 SV=1 (Range: 1-106)  ali follow..  17  15...............FCFFEMGSFCCPSRSTVARSQLTAASTS............................................................................................. 42

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;