current user: public

Query: 2LAA Entity 1(prereleased), from PDB0312

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 2.000e-27gi|308071397|ref|YP_003873002.1| beta/alpha-amylase precursor [Paenibacillus polymyxa E681]  clstr ali  89  455GGTGNKVTVYYKKGFNSPYIHYRPAGGSWTAAPGVKMQDAEISGYAKITVDIGSTSQLEAAFNDGNNNWDSNNTKNYLFSTGISTYTPGLNGAAGSIRTGAPSG 558
2 2.000e-27gi|374321076|ref|YP_005074205.1| unnamed protein product [Paenibacillus terrae HPL-003]  clstr ali  87  566GGTTNKVTIYYKKGFNSPYIHYRPAGGNWTAVPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYFFTTGTSTYTPGSNGAAGTVQTGSPSG 669
4 1.000e-26gi|113783|sp|P06547.1|AMYB_BACCI RecName: Full=Beta-amylase; AltName: Full=1,4-alpha-D-glucan maltohydrolase; Flags: Precursor  clstr ali  76  458GNPVNSVTIYYKKGFNSPYIHYRPAGGTWTDVPGVKMPDSEISGYAKITLDIGSASQLEAAFNDGNNQWDSNNMRNYFFSPGTSTYIPGTNGTAGSIQAGPPI. 560
5 1.000e-26gi|113784|sp|P21543.1|AMYB_PAEPO RecName: Full=Beta/alpha-amylase; Includes: RecName: Full=Beta-amylase; Includes: RecName: Full=Alpha-amylase; Flags  clstr ali  91  565GGTTNKVTVYYKKGFNSPYIHYRPAGGSWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYLFSTGTSTYTPGSNGAAGTIRTGAPSG 668
6 3.000e-26gi|337744750|ref|YP_004638912.1| alpha-amylase [Paenibacillus mucilaginosus KNP414]  clstr ali  52  944...GNSATVYYKPGYTTPYMHYRPAGGTWTTSPGTVMPASEIAGYHKLTVDLGASASLEAVFNNGSGTWDNNGGKNYIFPAGTSTYSGGVITSGPPP....... 1037
7 4.000e-25gi|115378360|ref|ZP_01465524.1| beta/alpha-amylase [Stigmatella aurantiaca DW4/3-1]  clstr ali  57  982..TGNTATVYYKKGFATPYIHYRPAGGTWTTPPGIAMPDAEVPGHAKYTVNLATATQLEAVFNNGSGTWDSNNGNNYFFPTGISTFNAGVITPGGPVV...... 1077
10 3.000e-23gi|189096677|gb|ABY56823.2| starch synthase IIIb precursor [Triticum aestivum]  clstr ali  18  724..AGTTVDVLYNPGSPEVWFRCSF--NRWTHPPPQKMVNEVNGSHLQATVRVPDAYMMDFVFSESGGIYDNRDGMDYHVPVSDSTAKEPPMHIVHIAVEMAPIA 836
12 4.000e-23gi|337745718|ref|YP_004639880.1| beta/alpha-amylase [Paenibacillus mucilaginosus KNP414]  clstr ali  77  457....NLVTIYYKKGFATPYLHYRPAGGTWTTAPGLKMADSEVSGYAKATVDIGSATQLEAAFNDGNNTWDSNATKNYFFGVGTFTYTPGANGAAGTIT...... 550
13 9.000e-23gi|271964823|ref|YP_003339019.1| unnamed protein product [Streptosporangium roseum DSM 43021]  clstr ali  39  472.PAGD-ATVYYATTWTAANIHYQPTGGTWTPVPGVAMDETACAGWKKKTVDLGTATGLKAAFNNGSGTWDNNGDRDYTIGRGVSTVKGGVVTAGATSPCGDGPG 573
14 9.000e-23gi|15612976|ref|NP_241279.1| alpha-amylase G-6 [Bacillus halodurans C-125]  clstr ali  41  863.GDATDITIYYKTGWTHPHIHYSLNQGAWTTLPGVPLTKSEYEGYVKVTIEAEEGSQLRAAFNNGSGQWDNNQGRDYDFSSGVHTLADGRILSGTP........ 957
15 2.000e-22gi|304405754|ref|ZP_07387412.1| Carbohydrate binding family 25 [Paenibacillus curdlanolyticus YK9]  clstr ali  47  617..AAQSATIYYKRGFSTPYIHYQVDGGSWTTAPGVALADSEFAGYSKITINLGASAGLTAAFNNGSGTWDNNGGQNYRFTAGTSTIVGSTITSGTP........ 710
17 9.000e-22gi|308069118|ref|YP_003870723.1| glycosidase [Paenibacillus polymyxa E681]  clstr ali  38  97...GNQAIVYYSRGWSDVNIHYAPDGSSWTSPPGISMNENACLDWAKKTIDLGSKTSMKAAFNNGN-VWDNNKGADYHLTAGLSTIKDGIVTTTGANNPCNPP. 198
19 3.000e-21METAHIT MH0081 GL0112326 [Complete] locus=scaffold42130_6:205:489:-  ali  50  7....NFATIYYKTRFDNPYIHYKVENKQWTNAPGVKMEASKPGYGYKITIDLDDDDKLTACFNNGNGNWDSNNGKNYTFTVGKYTYSSKK.............. 94
20 5.000e-21gi|118442733|dbj|BAF37284.1| alpha-amylase [Bacillus circulans]  clstr ali  47 1090.PAGNSATIYYNTAFSNSYIHYKLDGATWTTSPGVQMQASTFSGYKAITIPLGSATGLTAAFNNGSGIWDNNGGSNYHFGTGSSSLTGGNLITGEP........ 1186
21 6.000e-21gi|304407937|ref|ZP_07389587.1| alpha amylase catalytic region [Paenibacillus curdlanolyticus YK9]  clstr ali  61  875GTTDSAVTIYYKKGFATPYIHYRVEGGTWTTSPGVKMADSEIAGYAKFVIN--TSLRVEAAFNNGSGSWDSNATKNYFFNQGDNTYTPGANGAAGTVTPGKP.. 974
22 6.000e-21gi|97759|pir||S10789 amylase A-180 - alkaliphilic eubacterium 163-26  clstr ali  54  975.PEGNLVTIYYKKGFDTPYMHYRPEGGEWTIVPGIRMEESEIAGYSKLTVDIREASKLEVAFNNGRGAWDSDQENNYLFEPGVHTYIPSHEGRGEIIPPGAPI. 1078
23 8.000e-21METAHIT MH0013 GL0009669 [Complete] locus=scaffold18464_1:6073:6531:+  ali  26  28.........LFQDNCEEVYIHYGF-GLNWDNIGEIKMEKTELGFQAE--VELISSETFNFCFRNSKNEWDNNGGQNYVFPIEKVELA................. 102
24 1.000e-20gi|271964822|ref|YP_003339018.1| unnamed protein product [Streptosporangium roseum DSM 43021]  clstr ali  38  136....KQAVVYFHKGWSAANIHYQPTGGTWTPVPGVAMDETACADWARKTVDLGTATGLKAAFNNGSGTWDNNNGADYAIGTGLTTVKDGAVRANATEPCTP... 235
25 3.000e-20gi|357389266|ref|YP_004904105.1| unnamed protein product [Kitasatospora setae KM-6054]  clstr ali  42  498.GTGNSATVFYNRNWSAYDLHYAPTGGSWTTVPGVAM-DAACTGWVKKTVALGGATGLTATFNNGNGTWDNNGGNNYPLGAGNVTVKDGAVGSGDPC....... 594
27 6.000e-20METAHIT unmapped GL0638340 unmapped_[Lack_5`-end]_[mRNA]_locus=scaffold107659_3:1:717:+  ali  36  141.NASNHAIVYYNASWNKAFIHYCIAGGSWTSVPGIEMKKTDEGYNYKFDLDLGDATEVRVCFNNGNGTWDSKNGTNYTLNQGTYGISNGTIS............ 235
28 9.000e-20METAHIT MH0065 GL0119870 [Lack 3`-end] locus=scaffold109386_1:3:389:-  ali  31  28.........LFQDGAESVFIHYGF-GENWDNINDISMEKTDLGFQAE--ISLGEGSTFNFCFNDGNGIWDNNNGQNYIFNLEKVS................... 100
29 1.000e-19gi|328887046|emb|CCA60285.1| secreted alpha-amylase [Streptomyces venezuelae ATCC 10712]  clstr ali  35  46..AENTATVFYTKNWARYNLHWAPDGGSWTTVPGVAME-AACTDWVKKTVSLGTAAGLQATFTNGSGTWDNNGGRNYALGTGSLTVKDGVIAHSDPCAGTGP.. 147
30 1.000e-19gi|118442732|dbj|BAF37283.1| isocyclomaltooligosaccharide glucanotransferase [Bacillus circulans]  clstr ali  46  797...GNTATIYYNTAFSNSYIHYKLDGATWTTSPGVPMQASTFSGYKSITIPLGTATGLTAAFNNGSGTWDSNGGNNYHFGTGSSSLVGGSLTTGEP........ 891
31 2.000e-19METAHIT MH0009 GL0013274 [Lack 5`-end] locus=scaffold101057_2:816:1253:-  ali  25  18.........LFEQNSDKVFIHYGF-GENWDNVSEIEMNKTDLGFQAE--LDLPSSEVLKLCFRNSENIWDNNNGSDYSFNIEKPQVA................. 92
33 3.000e-19gi|260892726|ref|YP_003238823.1| carbohydrate-binding protein [Ammonifex degensii KC4]  clstr ali  28  28..AGEEVTIFYNSGASQIYLHLGFGPDNWHRVQDLKMSRTSWGWVRTISIPFDE-ERLNFCFWDGAGNWDNNNGLNWSYIIHG..................... 113
34 3.000e-19gi|302869082|ref|YP_003837719.1| alpha amylase catalytic subunit [Micromonospora aurantiaca ATCC 27029]  clstr ali  38  152...GNTAEVWYHRGWTAANLHYRPAGGAWTTAPGVAME-TRCAGWARRIVDLGTATGLTAAFNNTAGAWDNNGGADYTLGAGRSVVDNGRVTAA----AADPCA 250
35 3.000e-19gi|304407065|ref|ZP_07388719.1| Carbohydrate binding family 25 [Paenibacillus curdlanolyticus YK9]  clstr ali  55 1196.PTTNKVTVYYKPGYGTPYIHYRPTGGTWTTAPGVQMAAAEVTGYFKITVDIGTATGLEAVFNNGSGTWDNNGGNNYNFGVGTWTFSSGTITAGVPVT...... 1292
36 4.000e-19gi|316997264|dbj|BAJ52728.1| alpha-amylase [Kocuria varians]  clstr ali  31  544..TSRELALHYAADWDAANVHYQVGDGAWTEVPGEAMAPA-CTGWFHTDISLGEAEEITAAFNDGVGTWDNNGGADYSIGSGTVQVADGTV------SEGDPCA 638
37 6.000e-19METAHIT MH0011 GL0072727 [Complete] locus=scaffold11528_1:176:646:+  ali  24  28.........FYQENSEKVTIHYGF-GNQWNNVNDIEMEKTELGFQTE--IDLLEGESFELCFKNEKDEWDNNDGKNYVFPLEKVS................... 100
38 6.000e-19METAHIT MH0058 GL0023882 [Lack 5`-end] locus=scaffold83050_1:27:791:-  ali  31  53........LYYSTGWEEAYAHYKVDGEDWTTLPGIKMEKTDEGYTHKLVVPFDTKKKVTVCFNNGKGNWDSKNGANYAVESGVYGVKNGVVSRLET........ 142
39 8.000e-19METAHIT MH0006 GL0198405 [Complete] locus=scaffold277365_2:3171:3674:+  ali  26  30...GSTVKIFFEDASEEVFIHYGF-GENWDNLSEIQMEKTDLGFQTEIT--LLNSDTFNFCFRNGNNEWDNNDSQNYVFELE...................... 110
40 9.000e-19gi|357388137|ref|YP_004902976.1| unnamed protein product [Kitasatospora setae KM-6054]  clstr ali  38  168.....SATVYYYTNWSAYDLHYAPNGGTWTTAPGVAMEPA-CTDWVKKTVPLGGATGLQATFTNGSGTWDNNGGRNYALGAGVATVRDGVVG------STAPCA 262
41 1.000e-18gi|357415074|ref|YP_004926810.1| alpha amylase [Streptomyces flavogriseus ATCC 33331]  clstr ali  39  43.ASASTATVFYYTNWSSYRLHYAPDGGSWTTVPGAAME-AACTDWVKLTVDLGSASGLAATFNNGSGLWDNNAGKNYALGTGAVTVKDGVVAHSDPC....... 140
42 2.000e-18gi|323702816|ref|ZP_08114475.1| carbohydrate-binding family 25 protein [Desulfotomaculum nigrificans DSM 574]  clstr ali  21  38..AGEEVVVFYNSGADEVYVHCGFGDNDWKSVQDLRMAKTGWGWVKSMTMP-DTPTRFNFCFHDSAQNWDNNNGHNWSFQVHDGQMNKH............... 129
43 2.000e-18gi|220932438|ref|YP_002509346.1| carbohydrate-binding protein [Halothermothrix orenii H 168]  clstr ali  24  17..AGETVQVRYNSGAEEVYLHYGFGTDKWDEVKDIKMSKVRD--QFQTNIDVETDKRFIFCFRDNAGNWDNNNGRNWSFEVHNGSLY................. 105
44 2.000e-18gi|182440402|ref|YP_001828121.1| alpha-amylase [Streptomyces griseus subsp. griseus NBRC 13350]  clstr ali  39  54........VFYSTDWSAYYLHYSPDGGSWTTVPGTRME-AACADWVKLTVPLGSAGGLKATFTDGSGTWDNNAGKNYDLGTGDITVRDGAVAHSDPC....... 144
45 4.000e-18gi|304407064|ref|ZP_07388718.1| alpha amylase catalytic region [Paenibacillus curdlanolyticus YK9]  clstr ali  46  937....NSVTIYYNTSFTNKYIHYSVNGTTWTTAPGVAMTASSFAGYSVVTIDLGAANGLKAAFNNGSGSWDNNNSANYSFGVGTYTLVNGSISTGVP........ 1030
46 5.000e-18gi|333979105|ref|YP_004517050.1| hypothetical protein Desku_1671 [Desulfotomaculum kuznetsovii DSM 6115]  clstr ali  24  35..AYDEITVFYNSGAEQVYLHVGFGDRNWRNVQDLRMSRTGWGFV--KTLEIPDESRFNFCFRDNAYNWDNNNGLNWSFEIHNGQ................... 121
47 6.000e-18gi|303279036|ref|XP_003058811.1| glycosyltransferase family 5 protein [Micromonas pusilla CCMP1545]  clstr ali  23  370.NAGDEVTIKYNPGAETVYI--TGGFNRWTNIPETAMIPSAAAGVVEFKVKVPDAWMMDFVFSDGVGTYDNHFGRDYHVPIEGSTTERPPLHVMHVSVEMAPIA 488
48 6.000e-18gi|270284682|ref|ZP_05966488.2| putative S-layer y domain protein [Bifidobacterium gallicum DSM 20093]  clstr ali  34 1061....TTTTVYYPSGANSTYLHYRVNKNTWTTVPGVKME-AACDGWVKYTVDNPNQDEVEFVINNGAGAWDNNGEANYKGTGESLKLQNGTLTVDSAP....... 1159
49 7.000e-18gi|83590769|ref|YP_430778.1| carbohydrate-binding family 25 protein [Moorella thermoacetica ATCC 39073]  clstr ali  25  38..AGDEVTILYHGGADQVWMHTGYGDNNWQNVCDYRMERTGYG--WVKNIRVEDTSRLNICFKDSADNWDNNNGLNWSFEIHNG.................... 123
52 2.000e-17gi|270284681|ref|ZP_05966487.2| alpha-amylase [Bifidobacterium gallicum DSM 20093]  clstr ali  33  676.PVDQMTTIYYPSGKDSTYIHYRVGDGAWTVAPGEKMSEA-CDGWVSKRITTG-GKAVTFDFNNGAGAWDNNGGKDYTGKGTTLVVEKGQIGVTVPCKTT.... 775
53 2.000e-17gi|147679236|ref|YP_001213451.1| hypothetical protein PTH_2901 [Pelotomaculum thermopropionicum SI]  clstr ali  29  24..DGKKVSILYNGGAGEIYLHCGTGDSNWENISDLPMERKSNG--WEKTVRLESSRQLNFCFRDGINNWDNNGGANWAYRISG..................... 108
54 2.000e-17Oral.Meta HOMD sino_c_1_616 Scardovia inopinata F0304, DSM 10107 [263457 - 268898] ORF  ali  39  525..TDNTVTIYFKTDWKTPYIHHQTADG-WTDVPGEAMTKA-CDGYYSASVKLVDG-SLEFLFNDGNGTWDHPNGAD----SGNYTISKQVTVANGKISASAPCS 621
56 2.000e-17gi|371551090|gb|EHN78425.1| secreted alpha-amylase [Streptomyces coelicoflavus ZG0656]  clstr ali  35  53........VFYYTNWDRYNLHYAPDGGPWTEVPGVAME-SACADWVKKTVSLGSAEGLQATFNNGSGTWDNNAGGNYALGTGAVTVKDGVVAHSDPC....... 143
57 4.000e-17gi|134300175|ref|YP_001113671.1| carbohydrate-binding family 25 protein [Desulfotomaculum reducens MI-1]  clstr ali  26  38..AGQDVVVFYKDGAQEVYLHCGFGNNHWNAVQDQRMAKTGYGYVKAVTMP-ETHTQFNFCFHDNAYNWDNNSGKNWTFQVHNGT................... 125
58 4.000e-17gi|334091263|gb|AEG59603.1| carbohydrate-binding family 25 protein [Desulfotomaculum ruminis DSM 2154]  clstr ali  24  38..AGEEVVVFYNSGADQVYLHCGFGDANWRAVKDARMAKTGFGFVKVLEMP-DTHTQFNLCFRDSAQNWDNNNGINWSFQVHDGTINGH............... 129
59 5.000e-17gi|261337340|ref|ZP_05965224.1| pullulanase [Bifidobacterium gallicum DSM 20093]  clstr ali  30  547.PDDQTTTVWYKPNWDKVFVHHG-AGSDWTAEPGEQMEGPDAQGYYKKTIDT-KGEEHQICFNNGGSDWDSNNGANYLVAKGITHVENGTLTVGNPESIDA... 648
61 6.000e-17gi|270284680|ref|ZP_05966486.2| putative alpha-amylase [Bifidobacterium gallicum DSM 20093]  clstr ali  39  803.....STTIYYKFGANSTYLHYRVNKNTWTTVPGVKME-AACDGWVKYTVDNPNQDEVEFVINNGAGAWDNNGKKNYTGTGANLVIENGKVGTIAPC....... 900
63 7.000e-17gi|307108922|gb|EFN57161.1| hypothetical protein CHLNCDRAFT_143524 [Chlorella variabilis]  clstr ali  28  201....DTITVVYETGWGAAYVHHNVDGAGWTTVPGTQMQNGTQQFPDKKVLTVQ-GRRMEFVINNGGSDWDSSGSSNYVITPGTYRIKNGKVGR........... 295
64 7.000e-17gi|297616703|ref|YP_003701862.1| carbohydrate-binding family 25 protein [Syntrophothermus lipocalidus DSM 12680]  clstr ali  25  19..AGAEVNIKYNSGADAVYLHYGYGPDHWADVADLPMHRTSDG--FEASIKVKSNDRLNFCFKDSANNWDNNSGKDWSYTIHSG.................... 104
65 7.000e-17gi|304405535|ref|ZP_07387194.1| alpha amylase catalytic region [Paenibacillus curdlanolyticus YK9]  clstr ali  35  32.AAGNTATIYYYTNWTTTYIH-NNGSGSWTTVPGVLM-DAGCTNWTTKTIDFGTAASFQAVFTNGSGAWDNYNGQNYTFTAGIHQVKNGQIIANAGSPCGPP.. 136
66 9.000e-17METAHIT MH0067 GL0065742 [Complete] locus=scaffold5770_5:130:609:-  ali  27  28.........FFQDNSTELYIHYGF-GLLWENVNEIKMEKTELG--YQALIYLNGQDSLNFCFKNSNGEWDNNGGKNYIFEI....................... 97
68 1.000e-16gi|255078728|ref|XP_002502944.1| glycosyltransferase family 5 protein [Micromonas sp. RCC299]  clstr ali  22  370..AGEEVTITYHPEAQEVYL--TGGFNRWTHPEPVKMEKLGVGSAVTCKIKIPDAWMMDFVFSDGGSTYDNHFGKDYHIPIEGSTEEKPPLHVVHVSVEMAPIA 486
69 1.000e-16METAHIT MH0054 GL0079835 [Lack both end] locus=scaffold67821_2:3:590:+  ali  35  1....NTATVYYNNNFSNAYIHYKVGNGGWTNVPGIKMSTSDRSDHWMYTIDLGTNDTATVCFNNGSGNWDSKNGTNYTVKAGKYGISNEQV............. 89
70 1.000e-16gi|256833144|ref|YP_003161871.1| Alpha-amylase [Jonesia denitrificans DSM 20603]  clstr ali  31  496...GEALTVYYSTNWSNYRIHYRVGTDSWTTAPGAAMAPA-CTGWVSATVP-SNGSAVTAAFNNGSGTWDNNSGKDYTLTGSVAAVKGGAVTTHNPCSGGGGSA 596
71 2.000e-16gi|357039989|ref|ZP_09101780.1| hypothetical protein DesgiDRAFT_2896 [Desulfotomaculum gibsoniae DSM 7213]  clstr ali  25  35..SGEEITVLYDSGATQIYLHVGYGDARWRNIKAHRMSKTGWG--WVKTLEMPDDSRFNFCFHDGYGNWDNNNGLNWSFEIHNG.................... 120
72 2.000e-16METAHIT MH0012 GL0178204 [Complete] locus=scaffold121582_2:3048:3515:+  ali  27  28.........FFEDGSEEVFIHYGF-GTYWDNLSEIKMEKTELGFQAE--IELIESDTFNFCFRNEKNEWDNNNYENYIFELE...................... 97
73 2.000e-16gi|302391102|ref|YP_003826922.1| unnamed protein product [Acetohalobium arabaticum DSM 5501]  clstr ali  28  16..AGENVTIEYEAGAEEVYLHAGVGKEEWNDVKTIRMNRAPDGSW-KTTVRLNTTQDFKFCFKDAAENWDNNNGHNWSYQVHNG.................... 101
74 2.000e-16METAHIT MH0021 GL0001954 [Complete] locus=scaffold24994_2:662:1132:+  ali  25  28.........FFQDNSEKVSIHYGF-GNNWDNLTSTQMVKTELG--YQIEIEIGEVETFNFCFCNEKNEWDNNDGKNYIFVIEKQPVE................. 102
75 2.000e-16Oral.Meta HOMD pden_c_7_201 Parascardovia denticolens F0305, DSM 10105 [59801 - 65464] ORF  ali  31  526..SDRTVNVYYKTSWKTPYLHYQKESG-WTDLPGVAMAKA-CDGYYTASMPLDANHKQEFLFTDGGGNWDHPNGQNYSISKADLLVADGKLSEVTAAN--NPCA 631
76 3.000e-16METAHIT MH0081 GL0081256 [Lack 3`-end] locus=scaffold42130_10:1488:4898:+  ali  43 1021...DNSVILYYKGSATN--IHWRPLGGTWTKSPGDAMEPAEIDGYLKITLNVGTATGAEVCFNKNGTAWDNNGGKNYTINMGTNTFDNGKISA........... 1111
77 3.000e-16gi|366164629|ref|ZP_09464384.1| carbohydrate-binding family 25 protein [Acetivibrio cellulolyticus CD2]  clstr ali  30  23...GDEITLLYQSGADSIYAHIGY-GDNWEGKEFIPMEKMEDK--FKATIKVNLSDKLNVAFKDGVDNWDNNSQLNYSFNVAKSTSEEKKTTAKVKATSMN... 127
78 4.000e-16METAHIT MH0085 GL0054186 [Complete] locus=scaffold57024_1:1027:1572:-  ali  25  50.........LFQNGSEDVTVHYGF-GENWENAQDIQMVKTELG--YQADIHVQPNTKLNFCFKNANGEWDNNNGSNYAFKIEKN.................... 121
79 5.000e-16METAHIT MH0064 GL0042985 [Complete] locus=scaffold78481_1:99:566:-  ali  23  28.........FFQENSEKVFIHYGF-GKNWDNINEVEMVKTELGFQTE--IDLLGVETFNLCFKNEKNEWDNNEGQNYIFNLEKVS................... 100
80 6.000e-16METAHIT MH0082 GL0040582 [Complete] locus=scaffold2537_1:10470:10961:+  ali  25  28.........LFQNGSEDVMVHYGF-GENWEDAQDLQMQKSELGFQ--ADIYVKPNTKLNFCFRNSAGEWDNNEGSNYAFKIEKSNY.................. 101
81 8.000e-16METAHIT MH0030 GL0051268 [Lack 5`-end] locus=scaffold19428_6:3:1190:+  ali  42  1................QAYIHYRQADGTWTNVPGEKMSKSSNGYNWKATINLGNNSSTQVCFNDGNNNWDSRNAQNYTVSKGSYGIKNGTVTSV.......... 80
82 8.000e-16gi|168047756|ref|XP_001776335.1| predicted protein [Physcomitrella patens subsp. patens]  clstr ali  28  780......ISLYYESSWEYAYLHYSVDGSAWTELPGVCMRNGIVVNSMPLKVIDVEGDSIEFVLTDGRGSWDHPSGGNYHISSGTFLLSSGII............. 866
83 8.000e-16gi|326204456|ref|ZP_08194314.1| Carbohydrate binding family 25 [Clostridium papyrosolvens DSM 2782]  clstr ali  28  20..SGDKVILKYNGGAEDIYVHVGF-GESWDDRYFVTMTKENSSFVAE--IDIKDGKSCGICFKDAADNWDNNSGENYVFTISQKTVRKKSMTK........... 112
84 1.000e-15gi|125973595|ref|YP_001037505.1| carbohydrate-binding family 25 protein [Clostridium thermocellum ATCC 27405]  clstr ali  28  25..AGENLTVMYKSGASHVYAHVGFD-RDWKHVYDYPMKRTSIG--FEATIPVMEADTLNICFKDCANNWDNNSGANYTFDISK..................... 107
85 1.000e-15METAHIT MH0025 GL0112592 [Complete] locus=C3662344_1:224:703:+  ali  27  28.........FFQDNSTELYIHYGF-GLLWENVNEIKMGKTELG--YQALIYLNGQDSLNFCFKNGKGEWDNNEGKNYVFEI....................... 97
86 2.000e-15gi|376261825|ref|YP_005148545.1| unnamed protein product [Clostridium sp. BNL1100]  clstr ali  28  20..SGDKVILKYNGGAENIYVHVGF-GESWENKYFVSMTNENDTFIAE--IDIKDGKTCGMCFKDAADNWDNNSGENYVFNISKKTVRKKNVTKKTNIP...... 117
87 3.000e-15gi|145353247|ref|XP_001420931.1| predicted protein [Ostreococcus lucimarinus CCE9901]  clstr ali  20  393...GKPLKVFYNKNSEEIYL--TGGFNRWTAVAPMKMTPTEGEEFFSATVPPSDAWMVDFVFSSGVGQYDNKGGRDYHIPTRGSAAKKPPLHVVHVAVEMAPIA 506
89 4.000e-15gi|220929582|ref|YP_002506491.1| carbohydrate-binding family 25 protein [Clostridium cellulolyticum H10]  clstr ali  24  20..SGDKVILKYNGGAEGIYVHIGY-GENWDNRSFVPMKN--LNGIFEAEIDIQEGKICGICFKDSADNWDNNSGENYIFTISKKPARKKQTKKTSNV....... 116
90 5.000e-15gi|374295807|ref|YP_005045998.1| unnamed protein product [Clostridium clariflavum DSM 19732]  clstr ali  30  27...GENITILYKSGASHVYARVGF-GTNWDNETDYAMTKTDTG--FEVTIPVLKADTLNLCFKDCANNWDNNSGMNYSFDVAN..................... 108
91 5.000e-15gi|366162611|ref|ZP_09462366.1| carbohydrate-binding family 25 protein [Acetivibrio cellulolyticus CD2]  clstr ali  30  26..AGENITLMYKSGASHVYARIGF-GNSWDNESDYPMLRTDTG--FETTVPVLKADTLNVCFKDCANNWDNNSGMNYSFDVTK..................... 108
93 7.000e-15gi|374298014|ref|YP_005048205.1| unnamed protein product [Clostridium clariflavum DSM 19732]  clstr ali  30  18.AEGEKTTVLYNSGADEVYMRIGYGP-SWEDQKDIKMTKTSNG--FEAQIPITSQDKLNLAFKDSANNWDNNSGANYSFNIES..................... 101
94 9.000e-15METAHIT MH0076 GL0010600 [Lack 3`-end] locus=scaffold68589_1:2:370:-  ali  29  28.........LFQNNCDKVFAHYGF-GNEWAYLSDVEMHKTELGFQAE--IKLVSNEPLNLCFRSSNNLWDNNEGKNYSFDIEK..................... 98
96 1.000e-14gi|302853908|ref|XP_002958466.1| hypothetical protein VOLCADRAFT_108148 [Volvox carteri f. nagariensis]  clstr ali  23  462.....EIVLLYRSSWPEAFLHCNVEGRGWTAVPGLRMEHA---GAKEYAVRLP-GRSVEFVLTNGHGEWDSPGGRNYHITPGEYRLHYGVLAQVKA........ 553
97 2.000e-14NEWGM CHLVUL jgi|Coc_C169_1|65989|estExt_Genemark1.C_70237|Coccomyxa sp. C-169/Chlorella vulgaris C-169 |JGI  ali  31  66.QQGPSITITYQTGWNRAFLHYNVDGRGWTQVPGEEMENGDLAGNRVKTV---SGRRVEFVINNTEGGWDSTGSKNYVIAPGRYHLKSGRI............. 159
98 2.000e-14gi|337746398|ref|YP_004640560.1| alpha amylase [Paenibacillus mucilaginosus KNP414]  clstr ali  28  30.GAAATATVYYYTNWSKVNIHHNASG-SWTTVPGTPM-DAACTNWTGKTVEIA-GTSFQAVFTNGSGAWDNNGGSNYTMGAGVHQVKDGKLLAGAGSPC..... 127
99 3.000e-14gi|338811757|ref|ZP_08623962.1| carbohydrate-binding family 25 protein [Acetonema longum DSM 6540]  clstr ali  28  21....DKVKIIYQSGAAQVYAHVGF-GNNWTKTSDHKMKKTRKG--FETSLPTPDDAILNIVFKDCADHWDNNSGQNYSFVV....................... 99
100 4.000e-14gi|374297155|ref|YP_005047346.1| unnamed protein product [Clostridium clariflavum DSM 19732]  clstr ali  32  23...GDEVTLFYKSGADSVYAHIGY-GDNWEHKEFIPMEKVAD--VFRATIKVNHPDKLNIAFKDSIDNWDNNSYQNYSFNV....................... 102
101 5.000e-14gi|125975641|ref|YP_001039551.1| carbohydrate-binding family 25 protein [Clostridium thermocellum ATCC 27405]  clstr ali  31  23...GDEVTLYYKSGADAIFAHIGY-GENWEDKTFIPMQK--ENDVFKATIKINHADDLNIAFKDSGDNWDNNSWANYSFKVTKKAKPAKVVT............ 113
102 6.000e-14NEWGM PHYRM jgi|Phyra1_1|87156|fgenesh1_pg.C_scaffold_1617000001|Phytophthora ramorum |JGI  ali  28  142..DGTGLHVFFQTGWTTPYIHYS-TGSTWTTSPGNLMTASTDSGWFQYDLASPQA-SLEFVFNNGNGVWDNDNNANYKATSAGKWIVMSTLYPDRASP...... 241
104 2.000e-13gi|258516717|ref|YP_003192939.1| hypothetical protein Dtox_3604 [Desulfotomaculum acetoxidans DSM 771]  clstr ali  27  24.QDGREVTITYNSGAQEVYLHHGF-GDSWHGTGEFRMEKTPQGWQKTIVMQD---NQVVFCFKDNAQNWDNNDGHNW........................... 100
105 2.000e-13gi|68271034|gb|AAY89038.1| ApuB [Bifidobacterium breve UCC2003]  clstr ali  29  529.AADTSRTIYYKDGWKQAYLHYGIDG--WAEQGHELMADAGNG-WVKFTVD-PKGKSFEYVFTDGGDNWDNNGGGNYTAQGHWTAVADHEASAGVPS....... 623
106 2.000e-13gi|366165842|ref|ZP_09465597.1| carbohydrate-binding family 25 protein [Acetivibrio cellulolyticus CD2]  clstr ali  30  18.AEGDKATVLYNSGADAVYMRMGFGSG-WTNETNVKMARTQEG--FEAEIPVTSTDKLNLAFKDSASNWDNNSGSNYSFNVES..................... 101
107 3.000e-13NEWGM PHYRM jgi|Phyra1_1|73177|fgenesh1_pg.C_scaffold_2000242|Phytophthora ramorum |JGI  ali  30  142..DGTGLHVFFQTGWTTPYIHYS-TGSTWTTSPGNLMTASTDSGWFQYDLASPQA-SLEFVFNNGNGVWDNDNNANYKATSAGKWIVMSTVS............ 235
108 4.000e-13gi|260892936|ref|YP_003239033.1| hypothetical protein Adeg_1051 [Ammonifex degensii KC4]  clstr ali  32  24...GRDVLIRYKSGADRVFCHYGYDG--WKNINTVEMRR-EPDGSFVASVPVNGQSEINFCFKDSANNWDNNSGWNW........................... 99
109 5.000e-13gi|311115111|ref|YP_003986332.1| hypothetical protein HMPREF0421_21227 [Gardnerella vaginalis ATCC 14019]  clstr ali  34  527...DQSTTVYFNGNPSSVNIHYQIGNGSWTAVPGRPMRKV-CDGWFARTIP-NNGKQITAVFNDGGSNWYNKNGANFEIQAGSKTY.................. 615
110 5.000e-13METAHIT MH0030 GL0070065 [Lack 5`-end] locus=scaffold20418_3:328:1926:-  ali  39  440....NKLTVYYNNSWSSAYIHYKTDNGLWTVAPGVKMSISDNSDYWMYVIDLGDSLGATVCFNNGSGSWDSRNGSNYYLIGNQVGVTNGSV............. 528
111 6.000e-13gi|283783091|ref|YP_003373845.1| pullulanase, type I [Gardnerella vaginalis 409-05]  clstr ali  31  523.PEDPTTTIYFKPNGKKVYVHYGI-GSSWTQAPGDEMQKA-CDSWYKKTIRT-NGKVYEAVFNDGKGYWYHEGNNNFKIPAHTDSYHKGSVGVNPCPVAYNP.. 629
112 7.000e-13gi|308812598|ref|XP_003083606.1| Soluble Starch synthase III (IC) [Ostreococcus tauri]  clstr ali  28  584...GSPVTVRYCPGRESIVMHYGV--NDWMGASQVEMKKSQ-GGVFIATIDVPTALVMDVVFSDGSQTYDNNNKSDFHVPV....................... 665
113 1.000e-12gi|357041444|ref|ZP_09103219.1| hypothetical protein DesgiDRAFT_4338 [Desulfotomaculum gibsoniae DSM 7213]  clstr ali  26  23.QDGKEIRIRYKNGANQVWMHAGIGEEEWVDSKDYLMEKTSEG--WEHTVDV-KGKQFNFCFRDDAHNWDNNNGTNWIYRI....................... 105
114 1.000e-12gi|297243669|ref|ZP_06927600.1| Type II secretory pathway, pullulanase PulA glycosidase [Gardnerella vaginalis AMD]  clstr ali  31  523.PEDPTTTIYFKPNGKKVYVHYGI-GSSWTQAPGDEMKKA-CDGWYKKTIRT-NGKAYEAVFNNGENYWYHEGNNNFKIPAHTDSYHKGSVGVNPCPVAYNP.. 629
115 1.000e-12gi|303288379|ref|XP_003063478.1| soluble starch synthase [Micromonas pusilla CCMP1545]  clstr ali  26  754..AGGEVTVYYNAAATNLSITINSGCNNWEEPQKEVMQPVK--GRFKATVDVPDAFVMDFVFSDGGSEYDNNTRADYHVPI....................... 838
116 2.000e-12gi|258514588|ref|YP_003190810.1| hypothetical protein Dtox_1305 [Desulfotomaculum acetoxidans DSM 771]  clstr ali  22  24..DGNKVSVLYRAGAEKVIMHAGFGDNNWRNVKEIEMLKGQSGFEVSLDMKD---KQLNFCFKDNLSNWDNNSGNNWVYKI....................... 105
117 3.000e-12gi|168038775|ref|XP_001771875.1| predicted protein [Physcomitrella patens subsp. patens]  clstr ali  26  829.....TITLYYESSWEFAHLHYSADNSAWTELPGVCMRNEVLVNNVPVKVIDVEGNSIEFVLTDGKGSWD.................................. 893
118 3.000e-12NEWGM MICPC jgi|MicpuC2|48851|estExt_fgenesh1_pg.C_140161|Micromonas pusilla CCMP1545|JGI  ali  26  883..AGGEVTVYYNAAATNLSITINSGCNNWEEPQKEVMQPVKGSWWQKATVDVPDAFVMDFVFSDGGSEYDNNTRADYHVPI....................... 983
119 9.000e-12gi|256833145|ref|YP_003161872.1| alpha amylase [Jonesia denitrificans DSM 20603]  clstr ali  28  613..AGQT-TVYYNPNWVEHRFHYSVGLRGWTQVPGDLMYPA-CEGWVKKTIDTG-GEDIEGVFNSEGMEWDNNQEQNYHLSGRYVHVNEGTVTSGNPC....... 706
120 1.000e-11METAHIT MH0081 GL0104393 [Lack both end] locus=scaffold25406_2:2:655:+  ali  33  6....NQIRIYYYGDKQ--YAHYKIGNGQWTNVPGIEMEKALSEYPYKITLDLGNEKDATVCFXXXXXXXXXXXXRDYKFTAGTYKVSNGNVTK........... 94
121 2.000e-11METAHIT MH0011 GL0102562 [Complete] locus=scaffold89943_1:159:623:+  ali  25  28.........LFEENSKNVYLHYGY-GINWDNISDVEMTKSELG--YQAEIELMNSDSLNLCFRNSNNEWDNNNGQNYTFKIEKVEVA................. 102
122 2.000e-11gi|147678851|ref|YP_001213066.1| hypothetical protein PTH_2516 [Pelotomaculum thermopropionicum SI]  clstr ali  30  35..AGEEVTVLYNGGSGQVYLHYGYGGDDWRNVTDVRMEKTGWG-WVSSVVMPEHEGRFNFCFRDGANNWDNNNGLNWSFEIHNGS................... 122
123 3.000e-11Oral.Meta HOMD mmul_c_11_23 Mobiluncus mulieris ATCC 35243 [5201 - 5764] ORF  ali  34  70.PPDPQVTVYFKPGKGRYKLHYQKPDGAWTDNFGEKMDKA-CKGWWKRTI-TSEGLEFPMVINDGNNHWDNEGGANYDIPPRTDTY.................. 159
124 3.000e-11METAHIT MH0009 GL0093281 [Complete] locus=C5338783_1:78:545:+  ali  28  28.........FFQDNSEEVFLHYGF-GINWDNLNEIKMEKTELGFQAE--IFLGEGDTFNFCFRNGNNEWDNNNSQNYIFEIEK..................... 98
126 6.000e-11gi|332981592|ref|YP_004463033.1| hypothetical protein Mahau_1013 [Mahella australiensis 50-1 BON]  clstr ali  28  23...GERVIIRYKGQAQDIYAHVGYGPNNWQDVQDVKLQNSFNG--WQGTVDIKHGGRFNICFKDNNSRWDNNYGHNWSYEIHNGS................... 108
127 1.000e-10gi|366164395|ref|ZP_09464150.1| carbohydrate-binding family 25 protein [Acetivibrio cellulolyticus CD2]  clstr ali  28  56...GDKVILTYNSGANQVFATIGFGDNNWQNVSTSPMNN-KNQHMFELSIPAKDSGQINVAFKDSANNWDNNSGKNYSF......................... 136
128 2.000e-10gi|366166587|ref|ZP_09466342.1| hypothetical protein AcelC_23219 [Acetivibrio cellulolyticus CD2]  clstr ali  25  69....NTLRVLYKNGAKEIYAVIGYGDNNWENVQEYPMHKLSNKKY-ELIFPVNRAGEINMAFKDSANNWDNNSGRNFTFT........................ 149
129 2.000e-10gi|159484021|ref|XP_001700059.1| predicted protein [Chlamydomonas reinhardtii]  clstr ali  26  373............SGWGEVYLQCNPDGKGWTNPPGLRMEHS---GNKEFVMKLP-AKTVEFVVTNGKGEWDSPASKNYRIAPGEYRLHYGSLS............ 455
130 3.000e-10gi|357037319|ref|ZP_09099119.1| hypothetical protein DesgiDRAFT_0235 [Desulfotomaculum gibsoniae DSM 7213]  clstr ali  25  18...GNQINICYKSGADQVYLHCGYDPNNWQETITTNMDRTARG--WEQNVPMKNHT-MAFCFKDSANNWDNNSGHNW........................... 94
131 4.000e-10gi|225351932|ref|ZP_03742955.1| hypothetical protein BIFPSEUDO_03536 [Bifidobacterium pseudocatenulatum DSM 20438 = JCM 1200]  clstr ali  28  532.PDDRSVTIYYKPSWKSPKVHYGL-GDDW-NQPEADMT-LDEQGYYRATIDT-RGKKIDFVFHDGTDQWENPGGGNYHANAGITHVGV----ADQAATVGNP.. 629
132 6.000e-10gi|254443041|ref|ZP_05056517.1| Alpha amylase, catalytic domain subfamily, putative [Verrucomicrobiae bacterium DG1235]  clstr ali  22  36..AGEEITIFYDPGASRIFVYRAFNDWGAIAGPDQEMELDEETGVFSFSYRVSEAYGIDFVFRDANDNWDNNGGADWHVAV....................... 121
133 7.000e-10METAHIT MH0082 GL0020053 [Lack 5`-end] locus=scaffold57375_3:106:3063:-  ali  27  422.....TVTIYYNTSWANVNIHY--WSSPSTSWPGVAMTKVE-GNIWKYTFPRDPSGLQGFLFCDGLKSGDNGQTGDISGAPVNGHLYKGVGGPKGKVT...... 514
135 8.000e-10METAHIT MH0082 GL0071929 [Lack 5`-end] locus=scaffold2674_5:2:1822:+  ali  26  54......FTIYYDNNWNNVNIHY--WNSPKTDWPGTAMTKVKDN-VWQYTFSADPSGLDGFLFSDGSGSGDNNQTADYKQAPVKNHIYKGAGGNKGAVS...... 145
136 1.000e-09gi|240102071|ref|YP_002958379.1| glycoside hydrolase, family 57 [Thermococcus gammatolerans EJ3]  clstr ali  29  909..AGDTVTIYYNAGATSLTLHWGHDG--WKDVTDTPMQYS--NGVWKVAIETGSWGSLDFVFTNGS-VWDNDGWRDYHI......................... 987
137 1.000e-09gi|218289486|ref|ZP_03493714.1| alpha amylase catalytic region [Alicyclobacillus acidocaldarius LAA1]  clstr ali  25  823..AGQTITMVYATSSTSITMHWGY--NNWNGVSNVAMTKQANGTWTATITLPSSATSLNTAFFNQSSVWDNNGGQNYNFSV....................... 903
138 1.000e-09gi|56609602|gb|AAW03335.1| hypothetical protein [Cystobacter fuscus]  clstr ali  33  24.....TVTVYYYTAWSAPYIHHDASG-SWTTSPGTALSPA-CTNWVMKVLTTGTASTFQAVFTDGQNHWDNPNGANYNLPTGTHQVKNGQLLANAGSPCTT... 124
139 2.000e-09NEWGM OSTRC jgi|OstRCC809_1|26777|e_gw1.8.552.1|Ostreococcus sp. RCC809|JGI  ali  21  17..............KTDIFLHHGF--NNWNNAGKVQMQSAADGF-FAATIDVPTATVLDVVFSDGQGSFDNADRADFHAPVRNASEK................. 87
141 4.000e-09gi|326789245|ref|YP_004307066.1| alpha amylase catalytic subunit [Clostridium lentocellum DSM 5427]  clstr ali  31  486....SQATITYDNGASKVNIHWGYDG--WKGAKTESMTSLGSNKWFTLTVPSGATSNLDLVFNNGGSTWDNNNSTDYSITI....................... 567
142 4.000e-09gi|154487981|ref|ZP_02029098.1| hypothetical protein BIFADO_01549 [Bifidobacterium adolescentis L2-32]  clstr ali  20 1190....KSATVWYRPSSAQVRVQWRVYGSP-DTTGGMEMTQA-CGGWWKATVPSAGSTRVGLSFSYGSTT-DDNGGKLYDVKGESAAVSGGQAVTDVTPNCA.... 1284
143 4.000e-09gi|310820166|ref|YP_003952524.1| alpha amylase, catalytic domain subfamily [Stigmatella aurantiaca DW4/3-1]  clstr ali  32  23.....TATVYYYTGWSSAYLHHDASG-TWTAVPGTLM-GAACTHWLVKVVTTGTGNTFQATFTDGQNHWDNQSGANYLVPTGTHQVKNGQLL----SNAGNPCS 122
144 5.000e-09METAHIT MH0080 GL0065254 [Complete] locus=scaffold92688_1:1032:1493:-  ali  20  28.........LFQNNSEEVFIHYGF-GLNWDDLNEIKMEKTELGFQAE--LNLKSYDTFNFCFRXXXXXXXXXXXXXYVFPIEKVELS................. 102
146 6.000e-09gi|154487983|ref|ZP_02029100.1| hypothetical protein BIFADO_01551 [Bifidobacterium adolescentis L2-32]  clstr ali  20 1433....KSATVWYRPSSAQVRVQWRVYGSP-DTTGGMEMTQA-CGGWWKATVPSAGSTRVGLSFSYGSTT-DDNGGKLYDVKGESAAVSGGQAVTDVTPNCA.... 1527
147 6.000e-09gi|150015553|ref|YP_001307807.1| alpha amylase, catalytic region [Clostridium beijerinckii NCIMB 8052]  clstr ali  25  584..ASKTTTIYYNGNSTSVILHWGY--NDFTNPTDVTMTKQSDGRWAATITIPSATYSLNMAFKNDSGSWDSNSSANYNYSI....................... 664
148 8.000e-09gi|306822863|ref|ZP_07456239.1| thermostable pullulanase [Bifidobacterium dentium ATCC 27679]  clstr ali  27  529.PDDRSVTIYYKPSWKTPKVHYGL-GDEW-NQPDADMI-LDAQGYYTATIST-KGKKIDFVFHDADDQWENPGGGNYSANAGITHVGV----ADQTSTVGNP.. 626
149 1.000e-08gi|154488290|ref|ZP_02029407.1| hypothetical protein BIFADO_01864 [Bifidobacterium adolescentis L2-32]  clstr ali  20 1171....KSATVWYRPSSAQVRVQWRVYGSP-DTTGGMEMTQA-CGGWWKATVPSAGSTRVGLSFSYGSTT-DDNGGKLYDVKGESAAVSGGQAVTDVTPNCA.... 1265
150 2.000e-08gi|325180193|emb|CCA14595.1| AlNc14C4G663 [Albugo laibachii Nc14]  clstr ali  26  70.....DFTVYYQTKWTSPWMRYK-EGDKWTSV--EMMKSNTFGGYYWFRYRVRSVSPLYYVFTDGVTD-DDNGGSNYTAVSGGVWFTVSKIAPP.......... 159
152 4.000e-08gi|119025726|ref|YP_909571.1| pullulanase [Bifidobacterium adolescentis ATCC 15703]  clstr ali  25  533.ATDKTITIYYKPAWKTPKVHYGL-GDDW-NQPEADMT-LDEQGYYRATIDT-KGKKIDFVFHDADDQWENDGGGNYHANAGIIQVGV----AGQELSIGNP.. 630
154 4.000e-08METAHIT MH0081 GL0052594 [Lack both end] locus=scaffold42130_13:1:2298:+  ali  45  649...DNSVVLYYKGAATN--IHWRPLGGTWTKSPGDAMEKSEVDGYLKITLNIGTATGIEACFNTNGGNWDNNGGKNYTINMGTNTFENGK.............. 736
155 5.000e-08gi|187778591|ref|ZP_02995064.1| hypothetical protein CLOSPO_02186 [Clostridium sporogenes ATCC 15579]  clstr ali  22  68...............KKATLHYGVNG--WKDVKDVQLNRSVVDYYFYTTIYVEKGSKVDYCFKNEGTTWDNNNNKDYHIAVIESNVK................. 148
156 5.000e-08gi|182416724|ref|ZP_02948124.1| alpha-amylase [Clostridium butyricum 5521]  clstr ali  25  492...GNSIKITYNANSSTVKVHWGYD--SWTNPTNTTMTSSGNNTWTTTTVPSTATKDLDFSFTDG-TTWDNNNSANWTIPV....................... 573
157 6.000e-08gi|159475318|ref|XP_001695767.1| hypothetical protein CHLREDRAFT_181010 [Chlamydomonas reinhardtii]  clstr ali  16  395..AGEPAVLYVNGLSDDPNLKVHFGFNSWAVGGQEQCLKPTSLWSVPFMVPREAAD-MSFVLTNGAGTWDNNHGCNYVCTV....................... 478
158 9.000e-08gi|302834341|ref|XP_002948733.1| hypothetical protein VOLCADRAFT_58732 [Volvox carteri f. nagariensis]  clstr ali  16  154..AGQTVDVFYRPGRPEIWLR-----AAWNRLGAAPCLPGGLGFY-KATVQVPEAWGMDLSFSDSGGFVDDNGGLDYHVPVEGAVTPRRSLSIVHVAVEMAPIA 277
159 1.000e-07gi|296132403|ref|YP_003639650.1| carbohydrate-binding family 25 protein [Thermincola potens JR]  clstr ali  25  34...GEHINVIYNGLADGIWLHYGFGPNNWHDVKDLKMFKTGRG--WEHTFQVTDPTRLNFCFKDSANNWDNNNGLNWSFEIH...................... 116
160 1.000e-07gi|258516659|ref|YP_003192881.1| hypothetical protein Dtox_3542 [Desulfotomaculum acetoxidans DSM 771]  clstr ali  18  26.PDKKDVSIFYNSGATQVYLHTGTEDN-WNNVYDHRMEPTPYGFEKTIQI---ESNHLNFCFKDSA...................................... 91
161 1.000e-07gi|159471465|ref|XP_001693877.1| predicted protein [Chlamydomonas reinhardtii]  clstr ali  15  687..AGEPAVLYVNGLSDDPNLKVHFGFNSWAVGGQEQCLKPTSLWWWSVPFMVPEAADMSFVLTNGAGTWDNNHGCNYVCTV....................... 778
162 2.000e-07gi|167630836|ref|YP_001681335.1| hypothetical protein HM1_2795 [Heliobacterium modesticaldum Ice1]  clstr ali  24  32.GDGRDVTIVYDSGAQQVYLHAGY-GHDWKNTYDHRMERTCHGWQCTINM---EQDELRFCFKDSA...................................... 97
163 3.000e-07gi|344996255|ref|YP_004798598.1| hypothetical protein Calla_0980 [Caldicellulosiruptor lactoaceticus 6A]  clstr ali  21  14..AGDKLIVTYNNGEKEIYLKFGFGEEFAEGVYETKMIKK--NGEYIAVLPLLKSGILFFAFKDSFGNIDDNNGTFYKIGI....................... 97
164 4.000e-07gi|333979293|ref|YP_004517238.1| hypothetical protein Desku_1874 [Desulfotomaculum kuznetsovii DSM 6115]  clstr ali  26  16.PAGNEVNIIYNSGADQVYLHCGFGDKNWQNVSTIKMERTQRG--WESTLRMQNG-LMSFCFKDSANNWDNNNGYNWTVRA....................... 99
165 4.000e-07gi|297616702|ref|YP_003701861.1| carbohydrate-binding family 25 protein [Syntrophothermus lipocalidus DSM 12680]  clstr ali  16  19.NTGENLKIIYNSGADRVFLHMGYGPSTWASIHDQEMMRTDRG--FETTLKVERPDRINFCFKDSA...................................... 87
166 4.000e-07gi|359415005|ref|ZP_09207470.1| Alpha-amylase [Clostridium sp. DL-VIII]  clstr ali  22  587..AGKSITVYYNSSASSMTLHWGY--NNWASTNDVTMIKHSDGKW-SATITVPSGYMLNMCFKNNSDTWD.................................. 656
167 6.000e-07gi|307109240|gb|EFN57478.1| hypothetical protein CHLNCDRAFT_142998 [Chlorella variabilis]  clstr ali  26  46..........YRTSWQQPTLHRSINGGEW---QGVPMRQVSGGGWWEXXXXXXXXXXLEFVVTDGRDAWDKADGSNYAIAAGRWSLRDGQLAEASLP....... 147
168 7.000e-07gi|55792502|gb|AAV65348.1| plastid starch synthase isoform SS III [Prototheca wickerhamii]  clstr ali  20  126..AGQAVEVFYNPGRPEVYV--RGGFDRWTTFSPQAMRATGTGGFVTTTIQVPTAHVMDLVFMDSGGFIDDNRGLDYHMPVAG..................... 217
169 8.000e-07METAHIT MH0083 GL0116331 [Lack 5`-end] locus=scaffold80826_2:2:475:+  ali  30  19....QPMTVWYKPSWKTAKVHYQ-ANGKWTG-SAQQMT-LYRNGWYKYTIPDTAGGQVRMAFTDGGSAWDNNGGQ............................. 88
170 1.000e-06gi|148380786|ref|YP_001255327.1| unnamed protein product [Clostridium botulinum A str. ATCC 3502]  clstr ali  22  52...............KSATLHYGVNG--WKDVKDVQLNRSIVDYYFYTTIYVEKGSKIDYCFKKEGTKWDNNNNEDYHIFVTESNVK................. 132
172 1.000e-06gi|303285520|ref|XP_003062050.1| soluble starch synthase [Micromonas pusilla CCMP1545]  clstr ali  20 1221................QLFLHLGYNG--WQGEPQVDMRPNSGDWWIAEPVYVGESRVLDFVFSDGEGKYDNAGGSDYHTPCGDGETVDPV.............. 1309
173 2.000e-06gi|147678273|ref|YP_001212488.1| hypothetical protein PTH_1938 [Pelotomaculum thermopropionicum SI]  clstr ali  20  20.PDGKDITIIYNSGASQVFLHAGFGDANWRIVDDYRMQRTPEG--WKKTLNMEDST-LTFCFR......................................... 84
174 2.000e-06gi|125973473|ref|YP_001037383.1| hypothetical protein Cthe_0956 [Clostridium thermocellum ATCC 27405]  clstr ali  20  78........ILAKNNPENLYAVIGYGNNAWEDIESYSMRKIGDQKY-ELLFPVKRPGNINIAFKDDADNWDNNSGMNYCFENHVYQ................... 154
175 2.000e-06METAHIT MH0081 GL0036498 [Lack both end] locus=scaffold6671_2:2:1477:-  ali  33  2................................PGIKMNSSSDQGYSEYIIDLSKSSEITACFNNGNSLLDNNGGKNYKFTKGTFVIENGTIKKENAP....... 70
176 2.000e-06gi|15004871|ref|NP_149331.1| amyA gene product [Clostridium acetobutylicum ATCC 824]  clstr ali  23  481..AGDSVTITYDAGASNVNLYWGYDGFSAATSK--AMTSGDNKWQTTITVPKEVTKNVNFSFTDG-TSWDNNNGANWNIPLASNYLP................. 569
177 3.000e-06NEWGM ORYSA LOC_Os08g09230.1|12008.m26602|protein starch synthase III, putative, expressed|Oryza sativa|TIGR  ali  19  904..ANSTIDVYLNRNANEPDVHIKGAFNSWRWRPTERLHKSESGDWWSCKLHIPEAYRLDFVFFNGRLVYDNNDSNDFVLQVES..................... 991
178 4.000e-06gi|301100912|ref|XP_002899545.1| alpha-glucosidase, putative [Phytophthora infestans T30-4]  clstr ali  37  137.................PYIHFN-AGSGWTTVPGYAMSSSTYAGKFWYQYDTSSTSSVEITFDDGNGIWDSNLNANYITSPGTYAFVNQNTATPTSSPS..... 223
179 4.000e-06gi|218195622|gb|EEC78049.1| hypothetical protein OsI_17490 [Oryza sativa Indica Group]  clstr ali  17  436..AGDRVKLFYNRSSTEIWMHGGY--NNWSDSIAEKLIKSKDGDWWYADVTLPEGAVLDWVFADGARNYDNNGRQDFHAVV....................... 527
180 6.000e-06gi|169831324|ref|YP_001717306.1| carbohydrate-binding family 25 protein [Candidatus Desulforudis audaxviator MP104C]  clstr ali  20  24...DHHATIRYEGLADRVFIHYGFDG--WHNSSVTEMRR-EPDGSFACSIPMQGQRECNFCFKDAA...................................... 88
181 6.000e-06gi|307107015|gb|EFN55259.1| hypothetical protein CHLNCDRAFT_134595 [Chlorella variabilis]  clstr ali  24  341..AGAQCVVYFNRSQSEPLMHQGPKYNTWEVAAPVDMNRGEGVDYYSARVTIPDAFEMNFVFSNGDGVFDNNSSQNYLVPVTG..................... 437
182 3.000e-05gi|15004801|ref|NP_149261.1| amyA gene product [Clostridium acetobutylicum ATCC 824]  clstr ali  25  478...GQNITVTYNANSSLIKMHWGYD--SWKGTKDTSMTSLGNNWQATVTVPYEASSALNMVFTNGS-TWDNNNNQNWEFNIAK..................... 561
183 3.000e-05NEWGM MIMGU mgf015515m|Mimulus nasutus (Yellow monkey flower)|JGI  ali  13  403...DQDIEIFFNRSFSEPDVIIMGAFNDWKWKSFINLSKTQNGDWWSCKVYVPEAYKIDFVFYNGNDVYENNDEQDFCITVEGG.................... 490
184 4.000e-05gi|145347627|ref|XP_001418264.1| predicted protein [Ostreococcus lucimarinus CCE9901]  clstr ali  29  19........................................DQGSWWICEVEIPGASTVEFVFSDANGFYDNNSGKDYHCPV....................... 60
185 4.000e-05NEWGM SORBI jgi|Sorbi1|5006965|estExt_fgenesh1_pg.C_chr_62222|Sorghum bicolor|JGI  ali  20  532...GDRVRLYYNRSSTEIWMHGGY--NNWIDSIAEKLVKSKEGDWWYAEVTLPEALVLNWVFADGARNYDNNGRQDFHAIV....................... 622
186 5.000e-05gi|255081726|ref|XP_002508085.1| glycosyltransferase family 5 protein [Micromonas sp. RCC299]  clstr ali  18  17......................................DSGGGDWWIADYIHPEAKVLDFVFSNGEGQYDNAGGRDYHAPVG...................... 62
187 6.000e-05gi|255089202|ref|XP_002506523.1| glycosyltransferase family 5 protein [Micromonas sp. RCC299]  clstr ali  19  1.........................................................MDFVFADGKGTFDNNNRLDYHVDIKGGVLKEPPLHIVSISVEMAPIA 57
188 6.000e-05gi|302800371|ref|XP_002981943.1| starch synthase [Selaginella moellendorffii]  clstr ali  21  188..AGETVKLFYNRSSTELWIHGGY--NNWQDAVSVKLVPSSSGDWCSVEVSVPKAAMLNWVFADGASTYDNNDYQDFHMAV....................... 279
189 8.000e-05gi|154489159|ref|ZP_02030008.1| hypothetical protein BIFADO_02474 [Bifidobacterium adolescentis L2-32]  clstr ali  33  342..DDSTINVYFQKNWKEYYLHYQPKTG--TNWPAVKMTDADCSGYVVASIPKANAANHGYYFRNGNDGWYNSNGQNFKFWSGTYT................... 436
190 8.000e-05NEWGM CHLVUL jgi|Coc_C169_1|66167|estExt_Genemark1.C_80146|Coccomyxa sp. C-169/Chlorella vulgaris C-169 |JGI  ali  21  417..AGADVAVYFNNNVSDIQIHVKFNNGCWFDLEQTDAPHDFGADWWRVIVKVPDAFEMNYIFTDGEGATDNNMGQNY........................... 506
191 1.000e-04gi|258514096|ref|YP_003190318.1| hypothetical protein Dtox_0786 [Desulfotomaculum acetoxidans DSM 771]  clstr ali  26  35..AGQKTYILYNGGAHEVYLHMGYGDGKWHGVKEVRMEHTGWGFAKEFEAPFDNN--LNFCFRDNANNWDNNNGYNWTFQIHNG.................... 120
192 1.000e-04NEWGM OSTRC jgi|OstRCC809_1|40002|fgenesh1_pm.C_scaffold_1000266|Ostreococcus sp. RCC809|JGI  ali  18  19........................................DGGDWWVCDFKVDDASAIDFVFSDAEGFYDNNNNRDYHCLVES..................... 62
193 1.000e-04gi|302854176|ref|XP_002958598.1| hypothetical protein VOLCADRAFT_99865 [Volvox carteri f. nagariensis]  clstr ali  13  311..AGAPMKLYFNRNQSEPHIVLQYGYNHWELVPETPLPKNDTMDFWSCTVQVPEETEVNFILHDNNGLYENNNGMDFTYDVEAGITYD................ 411
194 1.000e-04gi|255554877|ref|XP_002518476.1| starch synthase, putative [Ricinus communis]  clstr ali  13  183...DQDIEVYLNNNEPDVFIMGAFNDWRWKSF-TIRLNKTHLGDWWSCQVHVPEAYKMDFVFFNGKNVYDNNDKKDFCTAVEGG.................... 270
195 2.000e-04NEWGM CYAME gnl|CMER|CMG185C hypothetical protein|Cyanidioschyzon merolae|"National Institute of Genetics, Japan"  ali  27  130.ATDQYIEILYRADWSQVYIMYAKQLNAWTSAPGELMNPEEQNLYFIRLL----AKELEFVLNNGGEEYDNCKGKNFKCTPGRYLV.................. 218
196 2.000e-04gi|302144135|emb|CBI23240.3| unnamed protein product [Vitis vinifera]  clstr ali  21  338...DDLVRLYYNRSANDIWIH--GGHNNWKDGSLIKDEKKEGDWWYVEVVVPERALVLDWVFADGASLYDNNHREDFHAIV....................... 428
197 3.000e-04gi|222529550|ref|YP_002573432.1| hypothetical protein Athe_1561 [Caldicellulosiruptor bescii DSM 6725]  clstr ali  22  14..AGDKLIVAYNNGEKDIYLKFGFGNEFVEGTYEIKMVKK--NGEYIAVLPLLKSGFLFIAFKDKFENFDDNNGNFYKISI....................... 97
198 3.000e-04METAHIT MH0081 GL0105641 [Lack 3`-end] locus=scaffold22481_6:66:1382:+  ali  29  37..TSNGIIIHYKDEYENPKIYYSLPKNLEVDWPGKKM-KSEDNGWFTYSFD--DVTKINFLFNDGNGNQTEDFSKD---KAGEYWYKDGK.............. 120
199 3.000e-04gi|359483436|ref|XP_002269011.2| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Vitis vinifera]  clstr ali  21  469...DDLVRLYYNRSANDIWIH--GGHNNWKDGSLIKDEKKEGDWWYVEVVVPERALVLDWVFADGASLYDNNHREDFHAIV....................... 559
200 4.000e-04gi|325684131|gb|ADZ44639.1| SSIII [Zea mays subsp. mays]  clstr ali  14  791..ADSTIDLYFNRDANEPDVLIKGAFNGWKRFFTEKLHKSELGDWWCCKLYIPKAYRMDFVFFNGRTIYENNDNNDFVIQIES..................... 878
201 4.000e-04gi|1911166|emb|CAA64173.1| soluble-starch-synthase [Solanum tuberosum]  clstr ali  23  521....DKVRLYYNKSAKDLWIHGGY--NNWKDGKLVKSERIDGDWWYTEVVIPDQALFLDWVFADGAIAYDNNHRQDFHAIV....................... 610
202 5.000e-04NEWGM BRADI Bradi3g15030.1|Brachypodium distachyon|JGI  ali  14  849..............ASEPDVVIKGAFNGWKRLFTERLNKSDLGGWWSCKLYIPEAYRLDFVFFNGRSVYENNGNNDFFIEIES..................... 920
203 5.000e-04gi|356555668|ref|XP_003546152.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Glycine max]  clstr ali  13  281...DQDIELFLNKNSEEPDILIMGAFNDWKWKSFIRLNKSDLGDWWSCQLYVPEAYKVDFVFFNEQNVYDNNDQKDFCIPVDGG.................... 368
204 6.000e-04gi|186695422|gb|ACC86846.1| starch synthase IIIa precursor [Sorghum bicolor]  clstr ali  19  976...GATIRLYYNINSTEIWMHGGY--NNWIDERLVHHNDKDSDWCFADVVLPERTYVLDWVFADGARNYDNNGGHDFHAT........................ 1065
205 6.000e-04gi|357166057|ref|XP_003580583.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Brachypodium distachyon]  clstr ali  17  401..ADSVIDLYLNRSASESTILIKGAFNGWRNLFTEKMHRSELGDWWCCKLHIPKAYRLDFVFFNGDTVYENNNYNDFFIEIES..................... 488
206 7.000e-04gi|15004832|ref|NP_149292.1| unnamed protein product [Clostridium acetobutylicum ATCC 824]  clstr ali  26  69...............KNVYVHYSLDGGNWSDSPAAYVKTNPSDNYEVWKFKTPSSSEITYCFKNGQTYWDNNNGKNYVDGAGLSSVYVHDVKTYRNINSSN... 164
207 7.000e-04gi|357139639|ref|XP_003571388.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Brachypodium distachyon]  clstr ali  14  708..............ASEPDVVIKGAFNGWKRLFTERLNKSDLGGWWSCKLYIPEAYRLDFVFFNGRSVYENNGNNDFFIEIES..................... 779
208 7.000e-04gi|115460666|ref|NP_001053933.1| Os04g0624600 [Oryza sativa Japonica Group]  clstr ali  18  331.QADSVIDLYLNHSASEPDILIKGAFNGWRWKKTQKMHKSELGDWWCCKLHIPKAYRLDFVFFNGDTIYENNNHNDFVLQIES..................... 419
209 8.000e-04gi|307136216|gb|ADN34053.1| starch synthase [Cucumis melo subsp. melo]  clstr ali  11  271...DQNIELFFNRSLSEQDILIMGAFNDWK-WKSFTMRANVVGDWWSCQIHVPEAYKIDFVFLNGKDVYENNDGKDFCIYVEGG.................... 358
210 1.000e-03gi|334182479|ref|NP_001184965.1| starch synthase 3 [Arabidopsis thaliana]  clstr ali  18  379..AEDTVKLYYNTNSKELWLH--GGFNNWAELKDV--DPKSGNWWFAEVVVPGGALVIDWVFADGAFLYDNNGYQDFHA......................... 473
211 1.000e-03gi|4582789|emb|CAB40374.1| Starch synthase isoform SS III [Vigna unguiculata]  clstr ali  13  262...DEDIEVFLNKNSDEPDILILGAFNDWEWKSTIRLNKTHLDDWWSCQLYVPEAYKIDFVFFNGQSVYDNNDQKDFCIPVVGG.................... 349
212 1.000e-03gi|378407336|gb|ADZ30930.4| soluble starch synthase gene [Musa acuminata AAA Group]  clstr ali  22  295....DRVRLYYNRSATDIWIH--GGHNIWSEGLSIKLSHSEDGDWWSADVVVPDALVLDWVFADGAVIYDNNNRQDFHATV....................... 384
213 0.002gi|159474428|ref|XP_001695327.1| soluble starch synthase III [Chlamydomonas reinhardtii]  clstr ali  12  169.PAG--ATMYFNRNQSEPHIVMQYGFNHWELQPPAPTPKSDVTDFWTCRMQVPEETELNFILHDKAGAYENNNGMDFTYPVEAGIDYD................ 268
214 0.002gi|307107387|gb|EFN55630.1| hypothetical protein CHLNCDRAFT_133796 [Chlorella variabilis]  clstr ali  20  882.....................VRLGFNHWDDTADLGLAPAELDWWATKPFTVPEAFDMSFAFTDSQGKWENNEGHNYDVPVWR..................... 951
215 0.002gi|9502143|gb|AAF87999.1|AF258608_1 starch synthase III [Triticum aestivum]  clstr ali  15  759..............ANEPDVVIKGAFNGWKRLFTERLHKSDLGGWWSCKLYIPEAYRLDFVFFNGRTVYENNGNNDFCIGIEG..................... 830
216 0.002gi|356520063|ref|XP_003528685.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Glycine max]  clstr ali  18  377......VRLYYNRTSQEVWIH--GGHNNWMDKLSIRLVKTGSGDWWHADVVVPDAVVLDWVFADGASSYDNNNVQDFHAIVTKVI................... 468
218 0.002NEWGM MANES cassava11738.valid.m1|"Manihot esculenta (Cassava, Manioc, Tapioca)"|JGI  ali  23  339...GGLVQLYYNKSANDLWIHGGY--NNWNDEKLVKSERKEGDWWYANVVVPDQVLVLDWVFADGAIVYDNNQRQDFHAVVAK..................... 431
219 0.002gi|224078602|ref|XP_002305571.1| predicted protein [Populus trichocarpa]  clstr ali  17  310....DTIKLYYNKSANDLWVH--GGHNNWKDERLVSSDKKDGDWWYANVVVPDRAFVLDWVFADGATVYDNNHRQDFHAIVPNGIPEE................ 406
220 0.002NEWGM MANES cassava7868.valid.m1|"Manihot esculenta (Cassava, Manioc, Tapioca)"|JGI  ali  24  441......VQLYYNKSANDLWIHGGY--NNWNNVVVEKLLKSEDGDWWYANVVVPDALLLDWVFADGAMVYDNNHRQDFHAIV....................... 528
221 0.003gi|343170553|gb|AEL97579.1| starch synthase IIIa [Hordeum vulgare subsp. vulgare]  clstr ali  15  724..............ANEPDVVIKGAFNGWKKLFSERLHKSDLGGWWSCKLHIPEAYRLDFVFFNGRTVYENNGNNDFCIGIEG..................... 795
222 0.003gi|162459783|ref|NP_001106015.1| starch synthase IIIb-1 precursor [Zea mays]  clstr ali  16  326...............SDVFVKGAFNGWRW-NRFTETMHRSELGDWWCCKLYIPKAYRLDFVFFNGDTVYENNNHNDFFLEIES..................... 394
223 0.003gi|194747954|ref|XP_001956414.1| GF25195 [Drosophila ananassae]  clstr ali  29  302.........................................DTFSFKITLP-PSSKRLEFCITNDTEYWDNNDGKNYTISKRSPFYYN................ 350
224 0.004METAHIT O2 GL0124208 [Complete] locus=scaffold17714_3:3674:8683:+  ali  19 1372......FRVHFKNGWEHVYMHWADSSNPLTSWPGMQMTQGSDGYYV-AELSVSGTGTYNYVFNNGSG..................................... 1434
225 0.004gi|195378210|ref|XP_002047877.1| GJ11686 [Drosophila virilis]  clstr ali  26  262.....................VRVTWDDWKSQQDIFCTFARDTFSFKITLP-PSSKRLEFCITNENEFWDNNDGKNYTISKRSPFYYN................ 342
226 0.004gi|302834519|ref|XP_002948822.1| hypothetical protein VOLCADRAFT_89088 [Volvox carteri f. nagariensis]  clstr ali  26  511.......................................ADASSWLQATFTVPEAYEMHMAFSDGNGNWDNNDGANFYARVKMDMTAEQRSHTVEQAMAEGPA. 576
227 0.004gi|145354958|ref|XP_001421741.1| predicted protein [Ostreococcus lucimarinus CCE9901]  clstr ali  18  1....................................MEKTGADDTFIATVDVPTAAVMDFVFSDGGAIYDNADRADFHAPVRNAS................... 51
228 0.004gi|65335732|gb|AAY42381.1| soluble starch synthase III [Chlamydomonas reinhardtii]  clstr ali  11  329..AGAPLQMYFNRNQSEPHIVMQYGFNHWELQPPAPTPKSDVTDFWTCRMQVPEETELNFILHDKAGAYENNNGMDFTYPVEAGIDYD................ 429
229 0.004NEWGM DROPS Contig815_Contig5737|GENSCAN_predicted_peptide_22|421_aa|Drosophila pseudoobscura|Baylor  ali  27  330.........................................DTFSFKITLP-PSSKRLEFCITNDTEYWDNNDGANYTISKRSPFYYN................ 378
230 0.004METAHIT MH0006 GL0300805 [Lack 5`-end] locus=scaffold106382_2:304:552:-  ali  40  1.........................................................FNFCFRNEKNEWDNNNSQNYVF......................... 22

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 4 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Godzik A. Improving the quality of twilight-zone alignments. Protein Sci. 2000 Aug;9(8):1487-96.