|
|
current user: public |
|
| Query: 3Q8J Entity 1(prereleased), from PDB0312 |
| . 10 . 20 . 30 . | |||||||
| # | Score | Template | Links and tools | %id | First | XGCAFEGESCNVQFYPCCPGLGLTCIPGNPDGTCYYL | Last |
| 1 | -5.400 | d2bbga_ g.6.1.1 (A:) Amb V allergen {Giant ragweed (Ambrosia trifida), pollen [TaxId: 4214]} | ali model 3D-neighbors follow.. | 27 | 2 | DGLCYEGTNCGKVGKYCCSPIGKYCVCYDSKAIC... | 35 |
| 2 | -4.940 | d1eita_ g.3.6.2 (A:) mu-Agatoxin-I {Funnel web spider (Agelenopsis aperta) [TaxId: 6908]} | ali model 3D-neighbors follow.. | 30 | 2 | ..CVPENGHCRDWYDECCEGFYCSC............ | 24 |
| 3 | -4.680 | d1fu3a_ g.3.6.1 (A:) Conotoxin {Conus textile, Tx VIa [TaxId: 6494]} | ali model 3D-neighbors follow.. | 33 | 2 | ..CKQSGEMCNLLDQNCCDGYCIVLV........... | 25 |
| 4 | -4.470 | d1mb6a_ g.3.6.2 (A:) Huwentoxin-IV {Chinese bird spider (Selenocosmia huwena) [TaxId: 29017]} | ali model 3D-neighbors follow.. | 30 | 2 | ..CLEIFKACNPSNDQCCKSSKLVC............ | 24 |
| 5 | -4.260 | d1ttka_ g.3.6.1 (A:) Conotoxin {Sea snail (Conus magus), M VIIa [TaxId: 6492]} | ali model 3D-neighbors follow.. | 38 | 1 | ..CKGKGAKCSRLMYDCCTG................. | 18 |
| 6 | -4.130 | d1cixa_ g.3.6.2 (A:) Tachystatin {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} | ali model 3D-neighbors follow.. | 43 | 4 | ..CQLQGFNCVVRSYPCCRGLTCSYFPGSTYGRC... | 41 |
| 7 | -4.090 | d1mkna_ g.5.1.1 (A:) Midkine, a heparin-binding growth factor, N-terminal domain {Synthetic} | ali model 3D-neighbors follow.. | 28 | 12 | ......GSECAEWAWGPCTPSSKDCGVGFREGTC... | 39 |
| 8 | -4.060 | d1uypa1 b.29.1.19 (A:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | ali model 3D-neighbors follow.. | 9 | 102 | .....DSIAFSFRIHPENVYNILSVKSNQVKLEVFEL | 133 |
| 9 | -4.010 | d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]} | ali model 3D-neighbors follow.. | 25 | 132 | ...HFRATSLETLRNMVAAGSGITLLP.......... | 155 |
| 10 | -3.910 | d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | ali model 3D-neighbors follow.. | 3 | 60 | ...ELTDGAKSLKDLGVRDGYRIHAVDVTGGNE.... | 89 |
FFAS is supported by the NIH grant R01-GM087218-01
|
|
|
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Alonso A, Rahmouni S, Williams S, van Stipdonk M, Jaroszewski L, Godzik A, Abraham RT, Schoenberger SP, Mustelin T. Tyrosine phosphorylation of VHR phosphatase by ZAP-70. Nat Immunol. 2003 Jan;4(1):44-8. Epub 2002 Nov 25. |