current user: public




Query: 3upv_A mol:protein length:126 Heat shock protein STI1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFLast
1 -78.3003upv_A mol:protein length:126 Heat shock protein STI1  ali model  100  1SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRF 126
2 -72.0004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  21  11SQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENSY 136
3 -71.8002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  24  13.KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAK--MKYQECNKIVKQKA. 134
4 -70.7003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  20  8TPESDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKRKIEEANR 133
5 -70.6001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  25  11.KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKQECNKIVKQKAFER. 135
6 -70.0002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  36  8.DLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQY...... 126
7 -70.0002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  30  9SAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLR...... 128
8 -69.1001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  23  2.EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR........ 118
9 -69.0004gco_A mol:protein length:126 Protein STI-1  ali model follow..  39  11.ELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVR............. 122
10 -68.7001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  17  1GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQER... 130
11 -68.6004cgw_A mol:protein length:117 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  24  15KQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP....................... 117
12 -67.9003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  18  1SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKE...... 127
13 -67.1004kbq_A mol:protein length:139 E3 ubiquitin-protein ligase CHIP  ali model follow..  29  8SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRL................... 114
14 -66.8003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  29  6SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRL................... 112
15 -61.9004cgu_A mol:protein length:112 TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH  ali model follow..  22  3.SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQY-RLELAQGAVGSVQIPVVEVDELPEGYDR............... 111
16 -61.5002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  28  26.SSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALR............. 140
17 -58.6004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  19  6.DAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGREIAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKELEK.......... 127
18 -57.6002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model follow..  26  1SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKK... 123
19 -54.4004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  25  39.DEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQPRAQKIAEHR. 162
20 -52.9004ja7_A mol:protein length:488 Serine/threonine-protein phosphatase 5  ali model follow..  24  14LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPNDKDAKMKQECSKIVKQKAFER. 139
21 -52.8001wao_1 mol:protein length:477 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  24  3LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKQECNKIVKQKAFER. 128
22 -49.6003rkv_A mol:protein length:162 putative peptidylprolyl isomerase  ali model follow..  20  9.KSVEALRQKGNELFVQKDYKEAIDAYRDALELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASV-VAREMKIVTERRAEKK. 149
23 -49.6004i2w_A mol:protein length:961 Protein UNC-45  ali model follow..  25  6.QTAEEIRDEGNAAVKDQDYIKADELYTEALQLTTDEPVLYRNRAMARLKRDDFEGAQSDCTKALEFDGADVKALFRRSLAREQLGNVGPAFQDAKEALRLSPNDKGIVEVQRLVKANNDKIKQT. 135
24 -48.9003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  99  137.EKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQ... 258
25 -45.9002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model follow..  22  30.QSAFDIKEEGNEFFKKNEINEAIVKYKEALKKKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARKK. 169
26 -45.8004apo_A mol:protein length:165 AH RECEPTOR-INTERACTING PROTEIN  ali model follow..  16  12.KAVPLIHQEGNRLYREGHVKEAAAKYYDAIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPV-VSRELQALEARIRQKD. 152
27 -45.2003kd7_A mol:protein length:125 CTPR390  ali model follow..  25  6GNSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNL.............. 117
28 -43.9003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  13  1.ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQR... 122
29 -43.3001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  25  6GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNL.............. 117
30 -41.9002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  21  1...AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAI 123
31 -41.7002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  23  6GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAKQNL.............. 117
32 -41.6002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  20  4.KYALALKDKGNQFFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDA................... 108
33 -41.2002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  14  18.ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLR. 141
34 -41.0001p5q_A mol:protein length:336 FK506-binding protein 4  ali model follow..  22  141...STIVKERGTVYFKEGKYKQALLQYKKIVKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAR. 277
35 -40.6001kt1_A mol:protein length:457 FK506-binding protein FKBP51  ali model follow..  20  266.EQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNER. 404
36 -40.2003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  21  22QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSDFDGASIEPMLERNLNKQAMKVLNENL 150
37 -39.6003wxx_A mol:protein length:151 AcrH  ali model follow..  14  23TDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSAQLLAAAKPELAELAARAGIMLEVVKTK. 147
38 -39.6002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  16  15EDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTAR. 139
39 -39.6002if4_A mol:protein length:338 ATFKBP42  ali model follow..  20  177.GAADRRKMDGNSLFKEEKLEEAMQQYEMAIMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQK. 317
40 -39.1001kt0_A mol:protein length:457 51 KDA FK506-BINDING PROTEIN  ali model follow..  20  266.EQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNER. 404
41 -39.0002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  15  18SDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLK. 142
42 -38.9002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  15  18SDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLK. 142
43 -38.4002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  10  1...................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLRRLARED. 106
44 -38.0004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  16  40..DPEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTA. 162
45 -37.4004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  15  46........NLGTIQRRQGKLQEALISYTSALSGHTKNITILENRASLYTELGETEKALNDYNTLLIENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEKSVRARLGHAILEKMRGNYDES. 162
46 -37.3003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  10  29DDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE... 151
47 -36.9001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  19  9.VEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSR---ICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLID................. 113
48 -36.8003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  10  33DDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ....... 151
49 -36.6004i17_A mol:protein length:228 hypothetical protein  ali model follow..  20  4TTDPNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNATIEK................ 114
50 -36.5001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  18  15.MYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQL.................. 121
51 -36.4004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  12  57SEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRKHK.... 178
52 -36.2001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  27  9...AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG........................................ 91
53 -36.2003vtx_A mol:protein length:184 MamA  ali model follow..  13  39...VETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAV 161
54 -36.2003asd_A mol:protein length:200 MamA  ali model follow..  11  41..DVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEAL 164
55 -36.0003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  19  74.DNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVE.................. 180
56 -35.5001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  20  4.VEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLID................. 108
57 -35.5002q7f_A mol:protein length:243 YrrB protein  ali model follow..  15  117.ENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAIDIQPDHMLALHAKKL............ 229
58 -35.4003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  16  1GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYTELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAA.................. 124
59 -35.3003asg_A mol:protein length:186 MamA  ali model follow..  11  41..DVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEAL 164
60 -35.2001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  15  40DERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAK. 164
61 -35.2002kck_A mol:protein length:112 TPR repeat  ali model follow..  20  4.QNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDEKDVWAAKADALRYIGKEVEAEIAEARAK........................... 104
62 -34.7003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  18  71KAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPN...................... 174
63 -34.6003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  19  174SIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGP.................. 281
64 -33.6002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  21  9.VGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEE...................... 134
65 -33.5001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  18  203...LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAV 325
66 -33.4001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  18  214SIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGG............. 326
67 -33.1002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  22  5........KTIKELINQGDIENALQALEEFLQTEPVGDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKM-VMDILNFYNKDMYNQLE............................. 93
68 -33.1002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  14  5...EQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKA. 137
69 -33.0001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  14  3....LGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAY 145
70 -33.0003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  20  170.NDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTP.................. 276
71 -32.7003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  20  170.NDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTP.................. 276
72 -32.6004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  18  210MIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPH............. 322
73 -32.0004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  2........PLGSMRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDL.................. 101
74 -31.8004ga2_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  2........PLGSMRRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDL.................. 101
75 -31.4005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  15  722.MSHNVLYMRGQIAELRGSMDEARRWYEEALAISPTHVKSMQRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATECFLTALELEASSPAV.................. 828

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.