current user: public




3upvA
Query: 3upv_A mol:protein length:126 Heat shock protein STI1, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFLast
1 -72.1003upv_A mol:protein length:126 Heat shock protein STI1  ali model  100  1SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRF 126
2 -64.2002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  24  13.KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDA--KMKYQECNKIVKQKA. 134
3 -63.8003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  26  6SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRW. 130
4 -63.5001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  24  11.KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFE. 134
5 -63.4001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  23  2.EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR........ 118
6 -62.7002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  36  8.DLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQY...... 126
7 -59.8002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  26  25ASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDADQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISGPSS...... 147
8 -59.6003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  18  1SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ..... 128
9 -59.5003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  20  8TPESDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKRKIEEA.. 131
10 -59.3002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model follow..  23  2.SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEGYDR............... 110
11 -58.1002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  29  9SAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREA.... 130
12 -57.9002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model follow..  26  1SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKR.. 124
13 -57.7001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  17  1GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGREIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQER... 130
14 -53.1003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  98  136PEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQ... 258
15 -52.7003rkv_A mol:protein length:162 putative peptidylprolyl isomerase  ali model follow..  18  9.KSVEALRQKGNELFVQKDYKEAIDAYRDALELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVAREMKIVTERRAEKKA. 150
16 -50.8003kd7_A mol:protein length:125 CTPR390  ali model follow..  23  6GNSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNLGNAKQKQ....... 124
17 -50.4002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model follow..  21  30.QSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARKK. 169
18 -49.0002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  21  1...AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAI 123
19 -48.7001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  23  6GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQ....... 124
20 -47.5002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  21  6GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAKQNLGNAKQKQ....... 124
21 -45.6001p5q_A mol:protein length:336 FK506-binding protein 4  ali model follow..  21  139.EQSTIVKERGTVYFKEGKYKQALLQYKKIVKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAR. 277
22 -45.4001wao_1 mol:protein length:477 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  24  3LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKA... 125
23 -45.3002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  18  4.KYALALKDKGNQFFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSDFNDASIEPMLERNLNKQAMSKLKEKF 130
24 -44.1002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  18  10..GAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQL 156
25 -43.9001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  18  15.MYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQ................... 120
26 -43.5002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  16  15EDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALQPAHEALAARAGAMLEAVTARKDR. 142
27 -43.4001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  17  39DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYE.. 178
28 -43.4003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  13  2..DVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQR... 122
29 -43.3002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  16  18SDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEM. 145
30 -43.1002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  16  18SDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELKPEFKELSTRVSSMLEAIKLKKEM. 145
31 -42.9001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  17  34DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYE.. 173
32 -42.8002q7f_A mol:protein length:243 YrrB protein  ali model follow..  15  82SSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKAL 207
33 -42.5003asg_A mol:protein length:186 MamA  ali model follow..  11  39AFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEAL 164
34 -42.5003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  12  39AFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEAL 164
35 -42.4003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  21  22QAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSDFDGASIEPMLERNLNKQAMKVLNENL 150
36 -42.3002kck_A mol:protein length:112 TPR repeat  ali model follow..  19  4.QNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDNKDVWAAKADALRYIEGKEVEAEIAEARAKLE........................ 106
37 -42.0003asd_A mol:protein length:200 MamA  ali model follow..  11  39AFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEAL 164
38 -41.7001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  15  40DERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAK. 164
39 -41.6003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  10  29DDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE... 151
40 -41.3003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  14  1GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYTELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKK. 141
41 -41.2003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  16  71KAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANAAQDPDTK.. 194
42 -41.2002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  10  1...................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLRRLARED. 106
43 -40.7003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  17  174SIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENI....... 292
44 -40.7003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  10  33DDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ....... 151
45 -40.5002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  13  18.ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQR... 139
46 -39.5001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  17  214SIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENI....... 332
47 -39.0001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  26  6GNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG........................................ 91
48 -38.8001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  20  99.DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAV 223
49 -38.8002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  14  3.TAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKA. 137
50 -38.8002if4_A mol:protein length:338 ATFKBP42  ali model follow..  20  177.GAADRRKMDGNSLFKEEKLEEAMQQYEMAIMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQK. 317
51 -38.5001kt0_A mol:protein length:457 51 KDA FK506-BINDING PROTEIN  ali model follow..  20  266.EQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNER. 404
52 -38.4001kt1_A mol:protein length:457 FK506-binding protein FKBP51  ali model follow..  20  266.EQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNER. 404
53 -38.1003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  19  170.NDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGEAS............. 281
54 -38.0003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  19  170.NDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGEASRE........... 283
55 -37.6003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  15  2...............VLGLEAQAVPYYEKAIASGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAILFYADKLDETW 115
56 -37.4001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  15  2...PLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAY 145
57 -37.1003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  12  191.EDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAY 324
58 -35.7002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  12  5NQVSNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDA. 166
59 -35.5003v6t_A mol:protein length:499 dHax3  ali model follow..  336.QQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQL 460
60 -35.2002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  21  2.....DQLKTIKELINQGDIENALQALEEFLQTEPVGDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMD-ILNFYNKDMYNQLE............................. 93
61 -35.2002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  16  28DEARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQA. 154
62 -34.6002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model follow..  21  42.QNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINMAKLLQRRS. 168
63 -34.4003ffl_A mol:protein length:167 Anaphase-promoting complex subunit 7  ali model follow..  14  54PQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQ---------KKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKLAECYTVLKQDKDAIAILDGIPSRQRT...................... 148
64 -34.4003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  20  3.................................DPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEG... 92
65 -34.1001iyg_A mol:protein length:133 Hypothetical protein (2010003O14)  ali model follow..  13  2SSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSEDIRRGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKS.... 128
66 -33.9002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  16  41DEARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQA. 167
67 -33.8001nzn_A mol:protein length:126 Fission protein Fis1p  ali model follow..  12  1...GSHMEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRNDDIRKGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.... 124
68 -33.5003v6p_A mol:protein length:442 dHax3  ali model follow..  11  328PEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTNDH.................... 433
69 -33.1002v5f_A mol:protein length:104 PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1  ali model follow..  16  4..TAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS................................ 102
70 -33.0002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  29  3...AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS....................................................... 70
71 -32.8001tjc_A mol:protein length:108 Prolyl 4-hydroxylase alpha-1 subunit  ali model follow..  15  4..TAEDSFELGKVAYTEADYYHTELWMEQALRQLDDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS................................ 102
72 -32.5002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  16  472QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEEN....... 597
73 -31.9001pc2_A mol:protein length:152 mitochondria fission protein  ali model follow..  12  1......MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSDDIRKGIVLLEELLPKGSKQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.... 121
74 -30.2001ihg_A mol:protein length:370 Cyclophilin 40  ali model follow..  25  221.LISEDLKNIGNTFFKSQNWEMAIKKYTKVLKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDK. 360
75 -29.6003ro3_A mol:protein length:164 G-protein-signaling modulator 2  ali model follow..  14  6AAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQE...................... 121

FFAS is supported by the NIH grant R01-GM087218-01
5 9 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.