current user: public




Query: 3tva_A mol:protein length:290 Xylose isomerase domain protein TIM barrel, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst SNAMTSHKPYWPIGVFTSVDAGLGVHLEVAQDLKVPTVQVHAPHPHTRTREHAQAFRAKCDAAGIQVTVIFGGFDGESYADIPTTARTVGLVPLETRASRVAEMKEISDFASWVGCPAIGLHIGFVPESSSPDYSELVRVTQDLLTHAANHGQAVHLETGQESADHLLEFIEDVNRPNLGINFDPANMILYGTGNPIEALRKVARYVRSIHCKDALWAPVNERGKSWGQEVALGTGDVGMEAYLTTLWEIGYRGPLTIEREIPHDPVQQKKDLASALELLTGLRKKIANCLast
1 -98.2003tva_A mol:protein length:290 Xylose isomerase domain protein TIM barrel  ali model  100  1SNAMTSHKPYWPIGVFTSVDAGLGVHLEVAQDLKVPTVQVHAPHPHTRTREHAQAFRAKCDAAGIQVTVIFGGFDGESYADIPTTARTVGLVPLETRASRVAEMKEISDFASWVGCPAIGLHIGFVPESSSPDYSELVRVTQDLLTHAANHGQAVHLETGQESADHLLEFIEDVNRPNLGINFDPANMILYGTGNPIEALRKVARYVRSIHCKDALWAPVNERGKSWGQEVALGTGDVGMEAYLTTLWEIGYRGPLTIEREIPHDPVQQKKDLASALELLTGLRKKIANC 290
2 -57.8002zds_A mol:protein length:340 Putative DNA-binding protein  ali model follow..  19  1......MPRNFTLFTGQWADLPLEEVCRLARDFGYDGLELACWGDHLADPSYVDSRHQLLDKYGLKCWAISNHLVGQAVCDAIIDERHEAILPAGVRQRAAAEIKDTARAAARLGVDTVIGFTGSAIWHLERGYQDFADRWNPILDVFDAEGVRFAHEVHPYDYWTTHRALEAVGRPAFGLNFDPSHFVWQDL-DPVGFLWDFRDRIYHVDCKEARKRLDGRNGRRGWDFVSAGHGDVPWEDVFRMLRSIDYQGPVSVEWEDA---MDRLQGAPEALTRLKAFDFEPPS. 323
3 -57.4003dx5_A mol:protein length:286 uncharacterized protein AsbF  ali model follow..  14  1..........MKYSLCTHQLISFTDIVQFAYENGFEGIELWGTHAQNLEYETTERELNCLKDKTLEITMISDYLD---------------ISLSADFEKTIEKCEQLAILANWFKTNKIRTFAGQKGSADQQERQEYVNRIRMICELFAQHNMYVLLETHPDTLPSTLELLGEVDHPNLKINLDFLHIWESG-ADPVDSFQQLRPWIQHYHFKNISSADYLHAAGNRTGMVPLFEGIVNYDEIIQEVR--DTDHFASLEWFGHNAK----DILKAEMKVLTNRNLEVVT. 279
4 -55.6003cqh_A mol:protein length:295 L-ribulose-5-phosphate 3-epimerase ulaE  ali model follow..  18  3..SSGSLSKQIPLGIYEKAGECWLERLQLAKTLGFDFVEMSVDETDDWSREQRLALVNAIVETGVRVPSMCLSAH----------RFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYANNETRRRFRDGLKESVEMASRAQVTLAMEIMDNSISKALGYAHYLNNPWFQLYPDIGNLSAWD-NDVQMELQAGIGHIVAVHVKDTK--------PGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEM--SETAEDPAAEVAKARDWVKARMAKAG.. 284
5 -55.2003wqo_A mol:protein length:293 Uncharacterized protein MJ1311  ali model follow..  17  9KKSKWVLDMKFGVSSLVFLPESLTSSMEKIAEHNFDAWEIVCEGTHYLSPKNIKYLMELRDRYEVEIVVHA-----------PFSDLNPASMNERVRKLTVECIRDAIEGAFELDSEVVVVHPGYIPNYVSEILDNNFSTLSEIVEIAEDYGIKIGLENMPNTPESLLEIVKDIDSKNLGITFDIGHANTAGNPEFVEKLQNIGIGIIHVHAHD--------NNGYDDEHLKIGEGNINFIEVLEKLKEIGYDGVISIENKNIRDAVKSKEILKEYLEIVNEKVAEKEK. 290
6 -52.3004ovx_A mol:protein length:277 Xylose isomerase domain protein TIM barrel  ali model follow..  12  2..ALQTSASPFEISLAQWSLHKMDFAKIAKEEFGINAIEYVNYKGKAEDQAFLADLKKRADDHGVKSLLIMCD-----------GEGALGDADEAKRKKAVENHYKWVAAAKYLGCHSIRVNAQS-GGSYDEQLARAADGLRRLTEFAATHDINVIVENHGSNGAWLAAVMKKVDHPRCGTLPDFGNFRVSKDEDRYKGVEELMPFAKAVSAKSHDFDAAG------------NEIHTDYRKMMKIVASFGYKGYVGIEYEGSKISEDGIKATKKLLETVRSEMA..... 277
7 -46.4004kw2_A mol:protein length:265 Uncharacterized protein  ali model follow..  15  8..NLYFQGADWKVGIQTWTNLTLMETLDKTQQLGMGYAEAFFFQNYDLSDDNCALLRHEFKIRGIKPIAFGVASYGTN-----------------------EEWDKFFAFAHKIGAHIVTV-------------EPELNQLDYIESLAKKYDMEVAIHNHPYASAEVVEKALKGRSPLMGVCADIGHWKRVG-EDPLKNLQKLSGRIKVAHLKDL---------TDKMEDATWGTGILPVKAFVNELKRQHFNGLISIEYDDFKSDI---QEIRNSLEFLQKCSK..... 259
8 -46.3004k3z_A mol:protein length:331 D-erythrulose 4-phosphate dehydrogenase  ali model follow..  14  8AQTQGPGSMALTLSLVNRFAEPDDLIETVARDLRLRDLQLTH--QASTIRRLTRDMDRALQRTGVRVTSGMTGPYGRL--------NHFGHPDRDVRRYYVDWFKTFADIIGDLGGKSVGTQFAIFPARREELIKIAIDCWAEVAEHAAGAGLDYVFWE-GETIAECMKLQDRLTAANMWMMADIDHGDVTSANDPYAWARTVPKVSPIIHIKQSLMDKGGHRP---FTAAFNAKGRIQPEPLLKAFAEGGVDNEICLEKEREPNDREVIPQIAESVAFWAPHIDTGAK. 321
9 -45.8001yx1_A mol:protein length:264 hypothetical protein PA2260  ali model follow..  17  2..HMSLHPVSISLSSYGA-SRGQASFLPLLAMAGAQRVELR--EELFAGPPDTEALTAAIQLQGLECVFSSPL---------------------REDGQLNPELEPTLRRAEACGAGWLKVSLGLLPEQPD---------LAALGRRLARHGLQLLVENDQTRIEVLERFFRLAERQQLAMTFDIGNWRWQE-QAADEAALRLGRYVGYVHCKAVIRNRD-------GKLVAVPPSAADLQYWQRLLQHFPEGVARAIEYPLQGD--DLLSLSRRHIAALARLGQPQEE. 258
10 -45.4003p6l_A mol:protein length:262 Sugar phosphate isomerase/epimerase  ali model follow..  15  2..QTKAEKNGWRLGMQSYSLFPLTEALDKTQELGLKYIEIYPGHDFNLDAQTQKEIKELAASKGIKIVGTGVYVAEKS-----------------------SDWEKMFKFAKAMDLEFITC-------------EPALSDWDLVEKLSKQYNIKISVHNHPQKPENLLKAISG-RSQSLGSCSDVGHWRREG-LNQIDCLKQLKGRIISLHFKDIAPKKAGENE---QHDVIWGTGILDVKGMLKELKSQNFKGVFSIEYE--YNWENSVPDIKECIQYFNKTANEI... 261
11 -45.1004xsl_A mol:protein length:300 D-tagatose 3-epimerase  ali model follow..  13  3...........KVGMSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIG----------LKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEV--NDAKEAIAFADAVDSPACKVQLDTFHMNIEE-TSFRDAILACKGKMGHFHLGEA-------------NRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPSNGATDEEMDERARRSLQFVRDKLAGSRS. 294
12 -44.7004q7i_A mol:protein length:298 D-tagatose 3-epimerase  ali model follow..  13  3...........KVGMSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIG----------LKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEV--NDAKEAIAFADAVDSPACKVQLDTFHMNIEE-NSFRDAILACKGKMGHFHLGEQ-------------NRLPPGEGRLPWDEIFGALKEIGYDGTIVMELSNGATDEEMDERARRSLQFVRDKLAL.... 291
13 -44.6003qxb_A mol:protein length:316 Putative Xylose isomerase  ali model follow..  14  8....NLYFQGMKLGVVKRWLEPDRLAGLVRDDLGLEYVQYTY--PDIERDRRAIAYAKAFRKAGLTIESTFGGLASYTYNHFLAP-------TLELQSLGYQHLKRAIDMTAAMEVPATGMPFGSYPARREEIYAIARDMWIELAAYAKRQGLSLYVEPVPADAARLMADLDGRTEIPVRLLVDWGHALFEPLFDMDHWMDLCQPWIAAYHIQQTDGQLDRHWS--------TQPGVVTPQRLQDFWDKYALTDTFFAEILYPFEARDEDADMIASVKALKAASPAA... 310
14 -44.5002zvr_A mol:protein length:290 Uncharacterized protein TM_0416  ali model follow..  16  5SSGLVPRGSHMKLSLVISTKGDLRKGMELAKRVGYQAVEIAVRDPSIVD---WNEVKILSEELNLPICAIGTGQA------YLADGLSLTHPNDEIRKKAIERVVKHTEVAGMFGALVIIGLVRGRRESYEETEELFIESMKRLLELTE--HAKFVIEP--NTIDDALRILRKINSNRVGILADTFHMNIEE-VNIPESLKRAGEKLYHFHVADS-------------NRWAPGCGHFDFRSVFNTLKEIGYNRYVSVECLPLPGGMEEA--AEIAFKTLKELIIKLT.. 284
15 -44.3004pgl_A mol:protein length:298 D-tagatose 3-epimerase  ali model follow..  14  3...........KVGMSTEWMVDFPATAKRIAGLGFDLMEISLSEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFAS----------PDKSVRDAGTEYVKRLLDDCHLLGAPVFAQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEA--NDAKEAIAFADAVDSPACKVHLDTFHMNIEE-NSFRDAILACKGKMGHFHLGEQ-------------NRLPPGEGRLPWDEIFGALKEIGYDGTIVIELSNGATDEEMDERARRSLQFVRDKLAL.... 291
16 -44.3004pfh_A mol:protein length:298 D-tagatose 3-epimerase  ali model follow..  14  3...........KVGMSTEWMVDFPATAKRIAGLGFDLMEINLEEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFAS----------PDKSVRDAGTEYVKRLLDDCHLLGAPVFAQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEV--NDAKEAIAFADAVDSPACKVQLDTFHMNIEE-NSFRDAILACKGKMGVFHIGEQ-------------NRLPPGEGRLPWDEIFGALKEIGYDGTIVMELSNGATDEEMDERARRSLQFVRDKLAL.... 291
17 -44.3003kws_A mol:protein length:287 Putative sugar isomerase  ali model follow..  16  16GSDKTGKDLELKLSFQEGIGESLNEKLDFMEKLGVVGFEPGGGG----LAGRVNEIKQALNGRNIKVSAICAGFKGFILST-----------DPAIRKECMDTMKEIIAAAGELGSTGVIIVPAFN-PHTMETRDFLCEQFNEMGTFAAQHGTSVIFEP--RQVADAASLCRDINNPGVRCMGDFWHMTWEE-TSDMGAFISGGEYLQHVHVASRKRRSMPGE----------DGDADNYINGFKGLKMIGYNNYVSFECGCQGDR---NVVVPAAVKLLREQWEQA... 287
18 -43.5003vni_A mol:protein length:294 Xylose isomerase domain protein TIM barrel  ali model follow..  15  1.........AMKHGIEQEWEADYKYYIEKVAKLGFDILEIAASPLPFYSDIQINELKACAHGNGITLTVGHG----------PSAEQNLSSPDPDIRKNAKAFYTDLLKRLYKLDVHLIGGALYSYTIDKKGDWERSVESVREVAKVAEACGVDFCLEV--NTAQEGVDFVKQVDHNNVKVMLDTFHMNIE-EDSIGGAIRTAGSYLGHLHTGEC-------------NRKVPGRGRIPWVEIGEALADIGYNGSVVMEISNGADEKMLDREAQAALDFSRYVLECHKHS 294
19 -42.6002hk0_A mol:protein length:309 D-PSICOSE 3-EPIMERASE  ali model follow..  16  10....LYFQGHMKHGIEHEWSAKFGPYIEKVAKLGFDIIEVAAHHINEYSDAELATIRKSAKDNGIILTAGIG----------PSKTKNLSSEDAAVRAAGKAFFERTLSNVAKLDIHTIGGAL--QPVDKAGDYARGVEGINGIADFANDLGINLCIEV--NTAAEGVAFVKDVGKNNVKVMLDTFHMNIE-EDSFGDAIRTAGPLLGHFHTGES-------------NRRVPGKGRMPWHEIGLALRDINYTGAVIMEPSGGADIAKMDEDARNALAFSRFVLG..... 303
20 -42.5003lmz_A mol:protein length:257 Putative sugar isomerase  ali model follow..  17  8KPKAPKAVNPFHLGMYTFVNFDLDTTLKTLERLDIHYLCIKDFHPLNSTDEQIRAFHDKCAAHKVTGYAVG-----------------------PIYMKSEEEIDRAFDYAKRVGVKLIVG-------------VPNYELLPYVDKKVKEYDFHYAIHLHGPDIKTYPDATDVWLDPRIGMCLDVGHDLRNGC-DPVADLKKYHTRVFDMHIKDV------TDSSKAGVGIEIGRGKIDFPALIRMMREVNYTGMCSLEYE--KDMKDPFLGIAESIGYFKAVSD..... 255
21 -41.7002qw5_A mol:protein length:335 Xylose isomerase-like TIM barrel  ali model follow..  16  1..GMTKLPATSDIYISFFMRRIVVAHIKKLQRFGYSGFEFPIAPGLPEDLENYTNLRHYLDSEGLENVKISTNVG-------ATRTFDPSSNYPEQRQEALEYLKSRVDITAALGGEIMMIWSDELQEHLKVRYANAQPILDKLGEYAEIKKVKLAIEP--NKLSQLIEFLKGVKSKQVGVVIDSAHEILDGEG--QVEYLAQQGRLHYVQVSPP-------------DRGALHTSWLPWKSFLTPIVK-VYDGPIAVE-DPPNQYPNAYDIADEAIKVTRKELKKIGS. 334
22 -41.3003vyl_A mol:protein length:297 L-ribulose 3-epimerase  ali model follow..  15  1...MARIGIHSFVWSASSAQSELERTLANTRDAGFDLIEFSYLDPADVD---IGRLAKRIADLGLGVAISIG----------LPADGDISSADKAVAARGVEILNQTIALTRDLGGRKVAGHGLQVEAPTRDQWNRSAAALAKVAETAKAAGVTLNLEI--NTAAQGLAFIEDTGSDNIFLHLDTFHMNIE-EADVGLAIRHAAGKIGYVHIGESHRG-------------FLGTGNIDFAAIFDALTAIGYADDLSFESFSSEIVTDNMALAKHARAFIGLGLETARR. 286
23 -40.8003u0h_A mol:protein length:281 Xylose isomerase domain protein  ali model follow..  16  1.....SNAMEPCLHPTLVDETSLVLYLDLARETGYRYVDVPFHWEAEAERHGDAAVEAMFQRRGLVLANLGLPLN---------------YDSEPVFLRELSLLPDRARLCARLGARSVTAFLWSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAG-EHEDDLAQLPPEKVVYVHINDTRDAPEDAHDG---KRLLPGDGRIPLVPFLRGLYLAGYRGPVAAELHETPLDGTGESRARLVRERLEKLIALAK.. 280
24 -40.4001i60_A mol:protein length:278 IOLI PROTEIN  ali model follow..  15  1..........MKLCFNEATNSNLKLDLELCEKHGYDYIEIRTMDPEYLKDHSLDDLAEYFQTHHIKPLALNA--------------VFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIEEIKKSSVDVLTELSDIAEPYGVKIALECTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSN--IESLKQAGKKIFIYHIDDTEDFPIGFLTDE--DRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPE-KLTAEEAIQTAKKTTVDVVSKY... 275
25 -38.7003ju2_A mol:protein length:284 uncharacterized protein SMc04130  ali model follow..  13  1...MSLQVEGLSINLATREQCGFAEAVDICLKHGITAIAP----RDQVAAIGLGEAGRIVRANGLKLTGLCRG-------------GFFPAPDASGREKAIDDNRRAVDEAAELGADCLVLVAGGLPKNIDAARRMVVEGIAAVLPHARAAGVPLAIEACVNTLGQALDICETLG-PGVGVAIDVYHVWWDPDLANQIARAGKMKAILAHHICDWLVPTKDMLTDR----GMMGDGVIDLKGIRRRIEAAGFHGAQEVEIFSADNKRPADEVIATCVERYRNCCE..... 277
26 -38.6002q02_A mol:protein length:272 Putative cytoplasmic protein  ali model follow..  13  1..GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRN-SGSVTDDLNYNQVRNLAEKYGLEIVTINA---------------------NQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGTIVPP--EVTVEAIKRLSDLFARYDIQGLVESSLRSAVWAQQLIREAGSP-FKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQSEAEIEEQINRSVSLLLQ........ 272
27 -38.3003cny_A mol:protein length:301 Inositol catabolism protein IolE  ali model follow..  11  30...................DNNLQQLLSDIVVAGFQGTEVGGFFPG------PEKLNYELKLRNLEIAG-------------------SSYIIRDGIEKASEAFEKHCQYLKAINAPVAVVIFKDKPYFTDKEWDEVCKGLNHYGEIAAKYGLKVAYHHHMQTKEETDRLMANTDPKLVGLLYDTGHIAVSD-GDYMALLNAHIDRVVHVHFKDVRRSKEEEGSFLNGMFTVPGDGDLDFKPVYDKLIANNYKGWIVVEAEQDPSKANPLEMAQIAHRYIKQHLIE.... 300
28 -35.2003ayt_A mol:protein length:254 Putative uncharacterized protein TTHB071  ali model follow..  17  1..........MDVRLAFPLS-RAEEALPRLQALGLG-AEVYLDPALL---EEDALFQSLRRRFSGKLSV-----------HLPFWNLDLLSPDPEVRGLTLRRLLFGLDRAAELGADRAVFHSGIPPEEALERALPLAEALGLVVRRARTLGVRLLLENSHEPHPEALRPVLEAHAGELGFCFDAAHARVFSRTP--DPGPWLALAPEHLHLND--------TDGVYDRHWNLGRGVLGHGAWLRPYL----DRTMVLE---------VREDPEASLAFLQALAGEGRT. 244
29 -31.6003obe_A mol:protein length:305 Sugar phosphate isomerase/epimerase  ali model follow..  12  11TDAVSSATAGKKMGL-QELLQDMPNGLNRLAKAGYTDLEIFGYREDTTTFIASKDYKKMVDDAGLRISSSHLTPSLREYTK-------------ENMPKFDEFWKKATDIHAELGVSCM-VQPSLPRIENEDDAKVVSEIFNRAGEITKKAGILWGYHNHSNEFKRVLKFLKNTDPDKVMFELDV-YWAVMGQQDPVEWMENYPNRFKLLHIKD--------------RWIIGDSGMMNFPNIFKKAYEIGILGYY-VELEGDKKGRTQFEGVEKSAAYLQAA....... 301
30 -31.4003l23_A mol:protein length:303 Sugar phosphate isomerase/epimerase  ali model follow..  10  16GLQIYSLSQELY-------KGDVAANLRKVKDMGYSKLELAGYGKGAIGGVPMMDFKKMAEDAGLKI--ISSHVNPVDTSISDPFKAMIFKYSKEVTPKIMEYWKATAADHAKLGCKYL-IQPMMPTITTHDEAKLVCDIFNQASDVIKAEGIATGFGYHNHNME-YDLMLKDTDPSKVYFEMDV-YWTVMGQNDPVEYMQKHPDRIKVLHIKD--------------RAVFGQSGMMNFEMIFKQMYANGIKDYF-VELEQMPDGRTQFAGVKDCADYLIKA....... 299
31 -31.2002g0w_A mol:protein length:296 Lmo2234 protein  ali model follow..  13  9NANGNLKKCPITISSYTGTEVSFPKRVKVAAENGFDGIGLRAENYVDALAAGLEDMLRILDEHNMKVTEV---------------------TAEDRTAEQQKKEQTTFHMARLFGVKHINCGL-----LEKIPEEQIIVALGELCDRAEELIIGLEF-SGVADLQAAWRVAEACGRDNAQLICDTWHWARANQT--AESIKNVADRIVSIQLCDVHETPYKE-EESLHDRLAPGEGYGDTVGFAKILKEHGVNPVMGVEISDSMVATGLEYAALKVYNATKKVLDEA... 283
32 -27.9003ngf_A mol:protein length:269 AP endonuclease, family 2  ali model follow..  13  1.MAMPRFAANLSTMF---NEVPFLERFRLAAEAGFGGVEFL--------DFDADVIARELKQHNLTQVLF-----NMPPGDWAAGERGMAAISGREQEFR-DNVDIALHYALALDCRTLHAMSGITEGDRKACEETFIENFRYAADKLAPHGITVLVEP--VHQLEAVGLVKRVNRPNVAVQLDLYHAQIMD-GDLTRLIEKMNGAFSHVQIASVPDRHE------------PDEGELNYPYLFSVLESVGYRGWVGCEY-------NPRGKTESGLAWFAPYRDQSA.. 263
33 -27.7001k77_A mol:protein length:260 Hypothetical protein ygbM  ali model follow..  13  1...MPRFAANLSMMF---TEVPFIERFAAARKAGFDAVEFL--------NYSTLQIQKQLEQNHLTLALF-----NTAPGDINAGEWGLSALPGREHEAH-ADIDLALEYALALNCEQVHVMAGVVPAGEDAERAVFIDNIRYAADRFAPHGKRILVEA--SSQYQALAIVEEVARDNVFIQLDTFHAQKVD-GNLTHLIRDYAGKYAHVQIAGLPDRHE------------PDDGEINYPWLFRLFDEVGYQGWIGCEYKPRGLTEEG..................... 250
34 -24.7003ktc_A mol:protein length:333 Xylose isomerase  ali model follow..  12  34.....................STIDQINAAKEVGLSYVDL---PYPFTPGVTLSEVKDALKDAGLKAIGITPEIYLQKWSR------AFTNPDPAARAAAFELMHESAGIVRELGANYVKVWPGQFQVSHKNLWKLAVDGMRDLAGANPD--VKFAIEYKPREPRRTLLGIEDIGLDNVGVLLDFGHALYGG-ESPADSAQLIRGRLFGMDVND--------NLRGWDDDLVVGTVHTEIFEFFYVLKINNWQGVWQLDQF--PFRENHVEAAQLSIRFLKHIYRALDK. 299
35 -19.2004hno_A mol:protein length:288 Probable endonuclease 4  ali model follow..  13  2.......SHMIKIGAHMPISKGFDRVPQDTVNIGGNSFQIRSWSAKLPSDEAATKFKREMKKHGIDWENAFCHSG------------NLASPKDDIWQKSVELLKKEVEICRKLGIRYLNIHPGSLGTGEEEGIDRIVRGLNEVLN--NTEGVVILLENVSQKGEQLKKIRDLVDRDRVAITYDTCHGFDSGYDALLNEIESL-ERLKMIHLNDSK----YPLGAAKDRHERIGSGFIGEEGFAVFFSFKEIQEPWILE------TPGGNEEHAEDIKKVFEIIEKFG.. 286
36 -18.2002hcv_A mol:protein length:438 L-rhamnose isomerase  ali model follow..  11  77.....................GIFDKLDDCAVIQLTRATPNVSLHIPWDKADPKELKARGDALGLGFDAMNSNFSDAPGQAHSYKYGSLSHTNAATRAQAVEHNLECIEIGKAIGSKALTVWIG--QSNFTRAFERYLSAMAEIYKGLPD-DWKLFSEHKMYEPAGTNYLIAQTLGPKAQCLVDLGHHAPNTNIEMIVARLIQFGKLGGFHFNDSKYGDDD---------LDAGAIEYRLFLVFNELVDAEARGVKGFHIDQSHNVTDPIESLINSANEIRRAYAQA... 353
37 -18.2003xim_A mol:protein length:393 D-XYLOSE ISOMERASE  ali model follow..  13  24...........AFGDATRTALDPVEAVHKLAEIGAYGITFHDDDDAQTRDGIIAGFKKALDETGLIVPMVTTNL----FTHPVFKDGGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGRSAKDVSAALDRYREALNLLAQYSEDRGLRFAIEPKPNEPGHAIAFVQELERPEFGINPETGHEQMSNLNFTQGAQALWHKKLFHIDLNG-------QHGPKFDQDLVFGHGDLLNAFSLVDLLENGYDGPRHFDYKPSRT--EDYDGVWESARANIRMYLLLRE. 319
38 -17.7001qtw_A mol:protein length:285 ENDONUCLEASE IV  ali model follow..  16  4............IGAHVSAAGGLANAAIRAAEIDATAFALRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDS------------NLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEELARIAESINIALD--KTQGVTAVIENTAGQGEHLAAIIDGVEKSRVGVCIDTCHAFAAGYDECEKTFADFAKYLRGMHLNDAK----STFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGPLILE-------TINPDIWAEEIAWLKAQQTEKAV. 284
39 -17.5001bhw_A mol:protein length:393 XYLOSE ISOMERASE  ali model follow..  14  24...........AFGDATRTALDPVEAVHKLAEIGAYGITFHDDDDAQTRDGIIAGFKKALDETGLIVPMVTTNL----FTHPVFKDGGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGRSAKDVSAALDRYREALNLLAQYSEDRGLRFAIEPKPNTAGHAIAFVQELERPEFGINPETGNEQMSNLNFTQGAQALWHKKLFHIDLNG-------QHGPKFDQDLVFGHGDLLNAFSLVDLLENGYDGPRHFDYKPTEDYDGVWESAKANIRMYLLLKERAKA. 323
40 -17.1001bxb_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  15  24...........PFGDAVRERLDPVYVVHKLAELGAYGVNLHDEDPPQERDQIVRRFKKALDETGLKVPMVTANL----FSDPAFKDGAFTSPDPWVRAYALRKSLETMDLGAELGAEIYVVWPGRATGKARKVWDWVREALNFMAAYAEDQGYRFALEPKPNEPGSMLAFIHTLDRPEFGLNPEFAHETMAGLNFVHAAQALDAGKLFHIDLND-------QRMSRFDQDLRFGSENLKAAFLVDLLESSGYQGPRHFDAHATEDEEGVWAFARGCMRTYLILKERAEA. 318
41 -17.1001bxc_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  15  24...........PFGDAVRERLDPVYVGHKLAELGVHGVNLHDEDPPQERDQIVRRFKRALDETGLKVPMVTGNL----FSDPGFKDGGFTSRDPWVRAYAFRKSLETMDLGAELGAEIYVVWPGRATGKARKVWDWVREPLNFMAAYAEDQGYRFALEPKPNTVGSMLALIHTLERPEFGLNPEFAHETMAGLNFVHAAQALDAGKLLHIDLNG-------QRMNRFDQDLRFGSENLKAALLVDLLESSGYQGPRHFDAHATEDEEGVWAFARGCMRTYLILKERAEA. 318
42 -16.5004lnc_A mol:protein length:388 Xylose isomerase  ali model follow..  17  25...........PFGDATRRALDPVESVRRLAELGAHGVTFHDDDSDSEREEHVKRFRQALDDTGMKVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGGGAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPNQPGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGAQALWAGKLFHIDLNG-------QNGIKYDQDLRFGAGDLRAAWLVDLLESAGYSGPRHFDFKPTEDFDGVWASAAGCMRNYLILKERAAA. 319
43 -16.4001gw9_A mol:protein length:388 XYLOSE ISOMERASE  ali model follow..  17  25...........PFGDATRRALDPVESVQRLAELGAHGVTFHDDDSDSEREEHVKRFRQALDDTGMKVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGGGAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPNEPGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGAQALWAGKLFHIDLNG-------QNGIKYDQDLRFGAGDLRAAWLVDLLESAGYSGPRHFDFKPTEDFDGVWASAAGCMRNYLILKERAAA. 319
44 -16.4004hhl_A mol:protein length:388 Xylose isomerase  ali model follow..  17  25...........PFGDATRPALDPVEAVQRLAELGAYGVTFHDDDSDTEREAHVKRFRQALDATGMTVPMATTNL----FTHPVFKDGAFTANDRDVRRYALRKTIRNIDLAVELGAKVYVAWGGGAAKDVRAALDRMKEAFDLLGEYVTSQGIRFAIEPKPNTIGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGAQALWAGKLFHIDLNG-------QSGIKYDQDLRFGAGDLRAAWLVDLLESAGWEGPRHFDFKPTEDIDGVWASAAGCMRNYLILKERAAA. 319
45 -16.3006xia_A mol:protein length:387 D-XYLOSE ISOMERASE  ali model follow..  17  24...........PFGDATRTALDPVESVRRLAELGAHGVTFHDDDSDSERYEHVKRFRQALDDTGMKVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGGGAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPNEPGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGAQALWAGKLFHIDLNG-------QNGIKYDQDLRFGAGDLRAAWLVDLLESAGYSGPRHFDFKPTEDFDGVWASAAGCMRNYLILKERAAA. 318
46 -16.2001clk_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  17  24...........PFGDATRGALDPAESVRRLAELGAHGVTFHDDDTDSERAEHIKRFRQALDETGMKVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAQTYVAWGGGAAKDVRVALDRMKEAFDLLGEYVTSQGTPFAIEPKPNEPGHALAFIDGLERPEYGVNPEVGHEQMAGLNFPHGAQALWAGKLFHIDLNG-------QSGIKYDQDLRFGPGDLRAAWLVDLLESAGYEGPRHFDFKPTEDFDGVWASAAGCMRNYLILKERAAA. 318
47 -16.2001dxi_A mol:protein length:388 D-XYLOSE ISOMERASE  ali model follow..  17  25...........PFGDATRPALDPVETVQRLAELGAYGVTFHDDDSDTERESHIKRFRQALDATGMTVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIGNIDLAAELGAKTYVAWGGGGAKDVRDALDRMKEAFDLLGEYVTAQGLRFAIEPKPNEPGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGAQALWAGKLFHIDLNG-------QSGIKYDQDLRFGAGDLRAAWLVDLLETAGYEGPRHFDFKPTEDFDGVWASAAGCMRNYLILKDRAAA. 319
48 -16.2001muw_A mol:protein length:386 XYLOSE ISOMERASE  ali model follow..  17  24...........PFGDATRPALDPVETVQRLAELGAHGVTFHDDDSDTERESHIKRFRQALDATGMTVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAKTYVAWGGGAAKDVRVALDRMKEAFDLLGEYVTSQGIRFAIEPKPNEPGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGAQALWAGKLFHIDLNG-------QSGIKYDQDLRFGAGDLRAAWLVDLLESAGYEGPRHFDFKPTEDIDGVWASAAGCMRNYLILKERAAA. 318
49 -16.1003aam_A mol:protein length:270 Endonuclease IV  ali model follow..  17  2..........PRYGLSIAGKKGVAGAVEEATALGLTAFQIFAKSPRSLSPAEVEAFRALREASGGLPAVIHASY-----------------AEGELWEKSVASLADDLEKAALLGVEYVVVHPGSRPERVKEGALKALRLAGV------RSRPVLLVENGEKVGARFEELAWLVADTPLQVCLDTCHAYAAGYDDPLGVLDALDERVPVVHLNDSV----GGLGSRVDHHAHLLQGKIG-EGLKRVFLDPRLKDVFILE------TPRGPEEDAWNLRVFRAWLEE.... 269
50 -16.0001tz9_A mol:protein length:367 Mannonate dehydratase  ali model follow..  10  68.IESVAIHDAIKAGTDQR-DHYIDNYRQTLRNLGKCGISLVCYSFKPIFGWAKTDLAYENEDGSLSLLFDQAVVENMQPEDMYQLIHSQGFRLPGWEEERLQQFQELKAMYAGVTEEDL--------------VENLRYFLERVIPVCEEENIKMGIHPDDKNLADLKRILSLVDSPANGITFCTGSLGADPTNDLPTMIREIGHRINFVHFRNVKYLGEHRFEETAHPSV---AGSLDMAELMQALVDVGYEGVIRPDWDEKAMPGYGLYDRAMGLTYIQGLYEATKA. 356
51 -15.8003aal_A mol:protein length:303 Probable endonuclease 4  ali model follow..  17  2......LNHMLKIGVSMSGKKMLLAASEEAASYGANTFMIYTGAPQNIEELNIEAGRQHMQAHGI----------EEIVVHAPYIINIGNTTNLDTFSLGVDFLRAEIERTEAIGAKQLVLHPGHVGAGVEAGLRQIIRGLNEVLT--REQNVQIALETMAGKGSECGRTFEELANDKLSVCFDTCHTIVNDFDGVLEEFDRI-GRLKVLHINDSK----NPRGSRKDRHENIGFGHIGFAALNYIVHHPQLEDYVGEDKNNKKPPYKHEIAMLRAQSFDDQLLEKINA. 300
52 -15.4001did_A mol:protein length:394 D-XYLOSE ISOMERASE  ali model follow..  16  24...........PFGVATRKNLDPVEAVHKLAELGAYGITFHDNDTEAEREKILGDFNQALKDTGLKVPMVTTNL----FSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGRGSKDLAAALDRMREGVDTAAGYIKDKGLRIALEPKPNEPGHGLAFIEQLEHGDVGLNPETGHEQMAGLNFTHGAQALWAEKLFHIDLNG-------QRGIKYDQDLVFGHGDLTSAFFTVDLLENGYTGPRHFDYDGYDGVWDSAKANMSMYLLLKERALAFRA. 327
53 -14.0003ban_A mol:protein length:386 D-mannonate dehydratase  ali model follow..  13  29.....................TLEEIKAIPGMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDI-----------KQGKPNRDALIENYKTSIRNVGAAGIPVVLNLPGWDSSYSKEEMKAIIENIKAILPTAEEAGVKMAIHPDDTGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYALNRINFMHTRNVTAGAWGFQETAH----LSQAGDIDMNAVVKLLVDYDWQGSLRPDHDQTKTPGYGLYDRALGATYFNGLYEANMR. 360
54 -13.7001xp3_A mol:protein length:307 endonuclease IV  ali model follow..  17  2.......SSMLKIGVSMSGKKMLLAASEEAVSYGATTFMIYTGAPQNIEELNIEAGRKHMEQNGI----------EEIIIHAPYIINVGNTTKPETFQLGVDFLRMEIERTSALGVKQIVLHPGHVGAGADAGIQQIIKGLNEVLT--PDQTVNIALETMAGKGTECGRSFEEIANEKLSVCFDTCHTIVNNFDGVLNEFDKI-DRLQVLHINDSK----NVRGAGKDRHENIGFGHIGYKALHHIVHHPQLTHYVGEDKKDKKPPYKLEIEMLKNGTFDEGLLEKIKA. 300
55 -10.7004eac_A mol:protein length:414 Mannonate dehydratase  ali model follow..  10  119............MPVLDWTRTDLEYVLP-SKALRFDQIEFAAFEMHILKRPGAEA-EEEIAQAAERFATMSDEDKARLTRNI------IAGLPGAEEGYTLDQFRKHLELYKDIDKAKLR--------------ENFAVFLKAIIPVAEEVGVRMAVHPDDSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLRSTMREDNPKTFHEAAH-----NGDVDMYEVVKAIVEEEHRGHQMLDLKKKTNPGYSAIGRLKGLAEVRGVELAIQR. 403
56 -10.1002j6v_A mol:protein length:301 UV ENDONUCLEASE  ali model follow..  11  31TLRLAHLTEERVREKAAENLRDLERILRFNADHGFALFRIGQYDWEGAYEEELARLGALARAFGQRLSM------------HPGQYVNPGSPDPEVVERSLAELRYSARLLSLLGAEVLVLHLGGAYGEKGKALRRFVENLR----GEEEVLRYLALEN-DERLWNVEEVLKAAEALGVPVVVDTLHHALLPLEEALRLAFPTWRGRPKVHLASQDPKKRPGAHAFR----------VTREDWERLLSALPGPADVMVEAKGKEQGL....................... 288
57 -9.6903tc3_A mol:protein length:310 UV damage endonuclease  ali model follow..  11  30TIKLSSLSEERVLKVSSSNLLCLKNILEWNLKHEILFFRISSVNWKDKLSHILGDIGDFIKENSIRISM------------HPGQYVVLNSVREEVVRSSIMELKYHADLLDSMGIEKIQIHVGSSMNGKEESLNRFIENFRKLPSNISK---RLVIEN-DDKVFSVKDCLWISERTGIPVIFDNLHHSIESLNDALSLVRRTWKDRPMIDYSEQEPGEKPGVHATTINEE-------NFRRFVNEVDEVD----IMLEVKDKEISALKAVKVLKELNKLD......... 300
58 -9.6004oou_B mol:protein length:388 Beta-1,4-mannanase  ali model follow..  11  61................................................NGPALKDWINKVKASGGNTARVWVHVEGQVSPAFDSHGF---VTSTDSKKTLINDLSDLLDYANGQNVFLILVLFNGLFWDESKLNSYINNALTPMVNALKSKPSLAAWEVLNEPMKQILKTINWISS-----NADSKALVTVGSWSELTQTDSFGYRFYQMHTQNAPFKVNRWAYNVNDKPLLIGEQNEGIQNLYKYAYNNGYNGALTWQFNSGGDCSDTYSNQMYGMQALKG........ 365
59 -9.3503vup_A mol:protein length:351 Beta-1,4-mannanase  ali model follow..  11  40................................................NKNRIEPEFKKLHDAGGNSMRLWIHIQGETTPAFNDQGFVTG---PDKQGTMLDDMKDLLDTAKKYNILVFPCLWNALIKDQHKLQSYIDKALKPIVNHVKGHVALGGWDLMNELYQDILRFLNWQAD-----TTDPGALVTMGVWNPKSNTDHFNMNFYQFHSDEVAPFTHQASDYGLHKPIVVGEGGMTITQMFNYVYNHGYAGAWSWHLVQRGDNQRKGITNIKDKTSNGKIPISL... 351

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.