current user: public




3tvaA
Query: 3tva_A mol:protein length:290 Xylose isomerase domain protein TIM barrel, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst SNAMTSHKPYWPIGVFTSVDAGLGVHLEVAQDLKVPTVQVHAPHPHTRTREHAQAFRAKCDAAGIQVTVIFGGFDGESYADIPTTARTVGLVPLETRASRVAEMKEISDFASWVGCPAIGLHIGFVPESSSPDYSELVRVTQDLLTHAANHGQAVHLETGQESADHLLEFIEDVNRPNLGINFDPANMILYGTGNPIEALRKVARYVRSIHCKDALWAPVNERGKSWGQEVALGTGDVGMEAYLTTLWEIGYRGPLTIEREIPHDPVQQKKDLASALELLTGLRKKIANCLast
1 -91.6003tva_A mol:protein length:290 Xylose isomerase domain protein TIM barrel  ali model  100  1SNAMTSHKPYWPIGVFTSVDAGLGVHLEVAQDLKVPTVQVHAPHPHTRTREHAQAFRAKCDAAGIQVTVIFGGFDGESYADIPTTARTVGLVPLETRASRVAEMKEISDFASWVGCPAIGLHIGFVPESSSPDYSELVRVTQDLLTHAANHGQAVHLETGQESADHLLEFIEDVNRPNLGINFDPANMILYGTGNPIEALRKVARYVRSIHCKDALWAPVNERGKSWGQEVALGTGDVGMEAYLTTLWEIGYRGPLTIEREIPHDPVQQKKDLASALELLTGLRKKIANC 290
2 -64.2002zds_A mol:protein length:340 Putative DNA-binding protein  ali model follow..  19  1........MPRNFTLFTGQDLPLEEVCRLARDFGYDGLELACWGDHLADPSYVDSRHQLLDKYGLKCWAISNHLVGQAVCDAIIDERHEAIDAEGVRQRAAAEIKDTARAAARLGVDTVIGFTGSAESMIERGYQDFADRWNPILDVFDAEGVRFAHEVHPYDYWTTHRALEAVGRPAFGLNFDPSHFVWQD-LDPVGFLWDFRDRIYHVDCKEARKRLDGRNGRRGWDFVSAGHGDVPWEDVFRMLRSIDYQGPVSVEWE--DAGMDRLQGAPEALTRLKAFDFEPPS. 323
3 -62.1003cqh_A mol:protein length:295 L-ribulose-5-phosphate 3-epimerase ulaE  ali model follow..  18  3..SSGSLSKQIPLGIYEKAGECWLERLQLAKTLGFDFVEMSVDETDDWSREQRLALVNAIVETGVRVPSMCLSA---------HRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDNSISKALGYAHYLNNPWFQLYPDIGNLSAWD-NDVQMELQAGIGHIVAVHVKDTK--------PGVFKNVPFGEGVVDFERCFETLKQSGYCGPYLIEMW-SETAEDPAAEVAKARDWVKARMAKAG.. 284
4 -60.8003dx5_A mol:protein length:286 uncharacterized protein AsbF  ali model follow..  15  1..........MKYSLCTISLISFTDIVQFAYENGFEGIELWGTHAQNQEYETTERELNCLKDKTLEITMISDY---------------LDISLSADFEKTIEKCEQLAILANWFKTNKIRTFAGQKGSASQQERQEYVNRIRMICELFAQHNMYVLLETHPDTLPSTLELLGEVDHPNLKINLDFLHIWESG-ADPVDSFQQLRPWIQHYHFKNISSADYLHAAGNRTGMVPLFEGIVNYDEIIQEVRDTDHFASLEWF------GHNAKDILKAEMKVLTNRNLEVVT. 279
5 -55.2003cny_A mol:protein length:301 Inositol catabolism protein IolE  ali model follow..  11  5.....KAEKDIKWGIAPIGDNNLQQLLSDIVVAGFQGTEVGGFFPG------PEKLNYELKLRNLEIAGQWFS----------------SYIIRDGIEKASEAFEKHCQYLKAINAPVAVVSEQTKPYFTDKEWDEVCKGLNHYGEIAAKYGLKVAYHHHMQTKEETDRLMANTDPKLVGLLYDTGHIAVSD-GDYMALLNAHIDRVVHVHFKDVRRSKEEEGSFLNGMFTVPGDGDLDFKPVYDKLIANNYKGWIVVEAEQDPSKANPLEMAQIAHRYIKQHLIE.... 300
6 -53.2003u0h_A mol:protein length:281 Xylose isomerase domain protein  ali model follow..  15  1.......SNAMEPCLHPTLETSLVLYLDLARETGYRYVDVPFHWLEAEAERGDAAVEAMFQRRGLVLANLGLPLN---------------YDSEPVFLRELSLLPDRARLCARLGARSVTAFLWSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAG-EHEDDLAQLPPEKVVYVHINDTRDAPEDAHDGKR---LLPGDGRIPLVPFLRGLYLAGYRGPVAAEVLHETLDGTGESRARLVRERLEKLIALA... 279
7 -52.9001yx1_A mol:protein length:264 hypothetical protein PA2260  ali model follow..  16  3.......MSLHPVSISLSSSRGQASFLPLLAMAGAQRVELR--EELFAGPPDTEALTAAIQLQGLECVFSSPL---------------------REDGQLNPELEPTLRRAEACGAGWLKVSLGLLPEQ---------PDLAALGRRLARHGLQLLVENDQGRIEVLERFFRLAERLDLAMTFDIGNWRWQE-QAADEAALRLGRYVGYVHCKAVIRNRD-------GKLVAVPPSAADLQYWQRLLQHFPEGVARAIEYPL--QGDDLLSLSRRHIAALARLGQPQEE. 258
8 -52.7003p6l_A mol:protein length:262 Sugar phosphate isomerase/epimerase  ali model follow..  15  2..QTKAEKNGWRLGMYSFHLFPLTEALDKTQELGLKYIEIYPGHDFNLDAQTQKEIKELAASKGIKIVGTGVYVAEKS-----------------------SDWEKMFKFAKAMDLEFITC-------------EPALSDWDLVEKLSKQYNIKISVHNHPQPKPENLLKAISGRSQSLGSCSDVGHWRREG-LNQIDCLKQLKGRIISLHFKDIAPKKAGENE---QHDVIWGTGILDVKGMLKELKSQNFKGVFSIEYE--YNWENSVPDIKECIQYFNKTANEI... 261
9 -52.6001i60_A mol:protein length:278 IOLI PROTEIN  ali model follow..  14  1..........MKLCFNEATNSNLKLDLELCEKHGYDYIEIRTMDPEYLKDHSLDDLAEYFQTHHIKPLAL-------------NALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQVKEEIKKSSVDVLTELSDIAEPYGVKIALECTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMG-SNIESLKQADGKKIFIYHIDDTEDFPIGFLTDE--DRVWPGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYKLTAEEAIQTAKKTTVDVVSKY... 275
10 -52.2003lmz_A mol:protein length:257 Putative sugar isomerase  ali model follow..  17  8KPKAPKAVNPFHLGMYTFVNFDLDTTLKTLERLDIHYLCIKDFHPLNSTDEQIRAFHDKCAAHKVTGYAVGPI-----------------------YMKSEEEIDRAFDYAKRVGVKLIVG-------------VPNYELLPYVDKKVKEYDFHYAIHLHGPDIKTYPDATDVWLDPRIGMCLDVGHDLRNG-CDPVADLKKYHTRVFDMHIKDV------TDSSKAGVGIEIGRGKIDFPALIRMMREVNYTGMCSLEYE--KDMKDPFLGIAESIGYFKAVSDLT... 257
11 -52.1002ou4_A mol:protein length:290 D-tagatose 3-epimerase  ali model follow..  13  3...........KVGMFYTYMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIG----------LKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEV--NDAKEAIAFADAVDSPACKVQLDTFHMNIEE-TSFRDAILACKGKMGHFHLGEA-------------NRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGEEMDERARRSLQFVRDKLA..... 290
12 -51.2002zvr_A mol:protein length:290 Uncharacterized protein TM_0416  ali model follow..  16  5SSGLVPRGSHMKLSLVISTKGDLRKGMELAKRVGYQAVEIAVRDPSIVD---WNEVKILSEELNLPICAIGTG------QAYLADGLSLTHPNDEIRKKAIERVVKHTEVAGMFGALVIIGLVRGRRESYEETEELFIESMKRLLELTEHAKFVI--TDFINTIDDALRILRKINSNRVGILADTFHMNIEE-VNIPESLKRAGEKLYHFHVADSNRW-------------APGCGHFDFRSVFNTLKEIGYNRYVSVECL--PLPGGMEEAAEIAFKTLKELIIKLT.. 284
13 -50.9003ju2_A mol:protein length:284 uncharacterized protein SMc04130  ali model follow..  13  1...MSLQVEGLSINLATREQCGFAEAVDICLKHGITAIAPWRDQVAAIG---LGEAGRIVRANGLKLTGLCRG-------------GFFPAPDASGREKAIDDNRRAVDEAAELGADCLVLVAGGLPGNIDAARRMVVEGIAAVLPHARAAGVPLAIEACVNTLGQALDICETLG-PGVGVAIDVYHVWWDPDLANQIARAGKMKAILAHHICDWLVPTKDMLTDR----GMMGDGVIDLKGIRRRIEAAGFHGAQEVEIFSADNKRPADEVIATCVERYRNCCEG.... 278
14 -50.9002q02_A mol:protein length:272 Putative cytoplasmic protein  ali model follow..  13  1..GMNIEKTRFCINRKIAPGLSIEAFFRLVKRLEFNKVELRNDMPSGSDDLNYNQVRNLAEKYGLEIVTI-----------------NAVYPFNQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGT--IVPPEVTVEAIKRLSDLFARYDIQGLVESSLRSAVWAQQLIREAGSP-FKVLLDTFHHHLYEEAEKEFASRIDISAIGLVHLSGVEDTRPTEALADEQRIMLSEKDVMQNYQQVQRLENMGYRGIYAFEPFSSQSEAEIEEQINRSVSLLLQ........ 272
15 -50.7003VNI Entity 1(prereleased)  ali follow..  14  1.........AMKHGIEQEWEADYKYYIEKVAKLGFDILEIAASPLPFYSDIQINELKACAHGNGITLTVGHG----------PSAEQNLSSPDPDIRKNAKAFYTDLLKRLYKLDVHLIGGALYSYTIDKKGDWERSVESVREVAKVAEACGVDFCLEYLINTAQEGVDFVKQVDHNNVKVMLDTFHMNIEE-DSIGGAIRTAGSYLGHLHTGEC-------------NRKVPGRGRIPWVEIGEALADIGYNGSVVMEPFVRMGGTVGSREAQAALDFSRYVLECHKHS 294
16 -50.2003obe_A mol:protein length:305 Sugar phosphate isomerase/epimerase  ali model follow..  10  11TDAVSSATAGKKMGLQQELLQDMPNGLNRLAKAGYTDLEIFGYNPKNTTFIASKDYKKMVDDAGLRISSSHLTP-------------SLREYTKENMPKFDEFWKKATDIHAELGVSCMVQPSL-PRIENEDDAKVVSEIFNRAGEITKKAGILWGYHNHSKGTYIEELFLKNTDPDKVMFELDVYWAVMGQ-QDPVEWMENYPNRFKLLHIKDR--------------WIIGDSGMMNFPNIFKKAYEIGILGYY-VELEGDKKGRTQFEGVEKSAAYLQAA....... 301
17 -49.9002hk0_A mol:protein length:309 D-PSICOSE 3-EPIMERASE  ali model follow..  16  6SGENLYFQGHMKHGIEHEWSAKFGPYIEKVAKLGFDIIEVAAHHINEYSDAELATIRKSAKDNGIILTAGIG----------PSKTKNLSSEDAAVRAAGKAFFERTLSNVAKLDIHTIGGALHSYPVDKAGDYARGVEGINGIADFANDLGINLCIEHVLNTAAEGVAFVKDVGKNNVKVMLDTFHMNIEE-DSFGDAIRTAGPLLGHFHTGES-------------NRRVPGKGRMPWHEIGLALRDINYTGAVIMELSGGADIAKMDEDARNALAFSRFVLG..... 303
18 -49.1002qw5_A mol:protein length:335 Xylose isomerase-like TIM barrel  ali model follow..  16  1..GMTKLPATSDIYISFFMRRIVVAHIKKLQRFGYSGFEFPIAPGLAQDLENYTNLRHYLDSEGLENVKISTNVG-------ATRTFDPSSNYPEQRQEALEYLKSRVDITAALGGEIMMGPIVILQEHLKVRYANAQPILDKLGEYAEIKKVKLAIEPGPNKLSQLIEFLKGVKSKQVGVVIDSAHEILDGEG--QVEYLAQQGRLHYVQVSPPDRG-------------ALHTSWLPWKSFLTPIVK-VYDGPIAVEIFNAIPAPNAYDIADEAIKVTRKELKKIGS. 334
19 -48.9003kws_A mol:protein length:287 Putative sugar isomerase  ali model follow..  15  16GSDKTGKDLELKLSFQEGIGESLNEKLDFMEKLGVVGFEPGGGG----LAGRVNEIKQALNGRNIKVSAICAGFKG-----------FILSTDPAIRKECMDTMKEIIAAAGELGSTGVIIVPAFNLPHTMETRDFLCEQFNEMGTFAAQHGTSVIFEFYLRQVADAASLCRDINNPGVRCMGDFWHMTWEE-TSDMGAFISGGEYLQHVHVASRKRRSMPGE----------DGDADNYINGFKGLKMIGYNNYVSFECGCQG---DRNVVVPAAVKLLREQWEQA... 287
20 -47.9003l23_A mol:protein length:303 Sugar phosphate isomerase/epimerase  ali model follow..  11  5..VVDEVHAGKEIGL-ELYKGDVAANLRKVKDMGYSKLELAGYGKGAIGGVPMMDFKKMAEDAGLKIISSHVNPVDTSISD--PFKAMIFKYSKEVTPKIMEYWKATAADHAKLGCKYLIQ-PMMPTITTHDEAKLVCDIFNQASDVIKAEGIATGFGYHNVGDQIYDLMLKDTDPSKVYFEMDVYWTVMGQ-NDPVEYMQKHPDRIKVLHIKDRA--------------VFGQSGMMNFEMIFKQMYANGIKDYF-VELEQMPDGRTQFAGVKDCADYLIKA....... 299
21 -47.8003qxb_A mol:protein length:316 Putative Xylose isomerase  ali model follow..  13  9.....LYFQGMKLGVNLCFLEPDRLAGLVRDDLGLEYVQYTYDLPDIERDRRAIAYAKAFRKAGLTIESTFGGLASYT-------YNHFLAPTLELQSLGYQHLKRAIDMTAAMEVPATGMPFGSYPARREEIYAIARDMWIELAAYAKRQGLSMLYVSSAADAARLMADLDGRTEIPVRLLVDWGHALFEPEADMDHWMDLCQPWIAAYHIQQT-------DGQLDRHWSFTQPGVVTPQRLQDFWDKYALTDTFFAEIPFEARDEDVLADMIASVKALKAASPAA... 310
22 -45.2001k77_A mol:protein length:260 Hypothetical protein ygbM  ali model follow..  12  1...MPRFAANLSMMF---TEVPFIERFAAARKAGFDAVEFLF------YNYSTLQIQKQLEQNHLTLALFNTAPGD-------NAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPADAERYRAVFIDNIRYAADRFAPHGKRILVEA--SSQYQALAIVEEVARDNVFIQLDTFHAQKVD-GNLTHLIRDYAGKYAHVQIAGLPDRHE------------PDDGEINYPWLFRLFDEVGYQGWIGCEYKPRGLTEEGLGWFDA............... 256
23 -44.6002g0w_A mol:protein length:296 Lmo2234 protein  ali model follow..  11  9..NANGNLKKCPITISSYTEVSFPKRVKVAAENGFDGIGLRAENYVDAAGLTDEDMLRILDEHNMKVTEVEYITQWGT--------------AEDRTAEQQKKEQTTFHMARLFGVKHINCGLL-----EKIPEEQIIVALGELCDRAEELIIGLEFMSGVADLQAAWRVAEACGRDNAQLICDTWHWARAN-QTAESIKNVPADRIVSIQLCDVETPYKELREESLHDRLAPGEGYGDTVGFAKILKEHGVNPVMGVEVISDSVATGLEYAALKVYNATKKVLDEA... 283
24 -44.6003ngf_A mol:protein length:269 AP endonuclease, family 2  ali model follow..  11  1...MAMPRFAANLSTM-FNEVPFLERFRLAAEAGFGGVEFLF------YDFDADVIARELKQHNLTQVLFNMPPGDW------AAGERGMAAISGREQEFRDNVDIALHYALALDCRTLHAMSGITELDRKACEETFIENFRYAADKLAPHGITVLVEP--VHQLEAVGLVKRVNRPNVAVQLDLYHAQIMD-GDLTRLIEKMNGAFSHVQIASVPDRHE------------PDEGELNYPYLFSVLESVGYRGWVGCEYN-------PRGKTESGLAWFAPYRDQSA.. 263
25 -41.4003ktc_A mol:protein length:333 Xylose isomerase  ali model follow..  12  2....MATYNYPEFGAGYGPALSTIDQINAAKEVELSYVDLPYPFT---PGVTLSEVKDALKDAGLKAIGITPEIYLQKWSR------AFTNPDPAARAAAFELMHESAGIVRELGANYVKVWPGQ-QVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKMTWDSAARTLLGIEDIGLDNVGVLLDFGHALYGG-ESPADSAQLIIDRLFGMDVNDNLRGWDD--------DLVVGTVHTEIFEFFYVLKINNWQGVWQLDQF--PFRENHVEAAQLSIRFLKHIYRALDK. 299
26 -40.8001clk_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  15  11TFGLWTVGWQ-PFGDATRGALDPAESVRRLAELGAHGVTFHDDDLIPFRAEHIKRFRQALDETGMKVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAQTYVAWGGREAKDVRVALDRMKEAFDLLGEYVTSQGYDTPFAIEPPTIGHALAFIDGLERPEYGVNPEVGHEQMAG-LNFPHGIAQALWAGKLFHIDL-----NGQSGIKYDQDLRFGPGDLRAFWLVDLLESAGYEGPRHFDFPRTEDFDGVWASAAGCMRNYLILKERAAA. 318
27 -40.2003xim_A mol:protein length:393 D-XYLOSE ISOMERASE  ali model follow..  11  1...SVQATREDKFSF-TRTALDPVEAVHKLAEIGAYGITFHDDDLVQTRDGIIAGFKKALDETGLIVPMVTTNL----FTHPVFKDGGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREAKDVSAALDRYREALNLLAQYSEDRGYGLRFAIEPPTAGHAIAFVQELERPEFGINPETGHEQMSN-LNFTQGIAQALWKLFHIDLNG-------QHGPKFDQDLVFGHGDLLNAFSLVDLLENGPDGAPAYDFDYKPSRTEDYDGVWESARANIRMYLLLRE. 319
28 -40.1001bxc_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  15  1...MYEPKPEHRFTF-VRERLDPVYVGHKLAELGVHGVNLHDEDLIPRRDQIVRRFKRALDETGLKVPMVTGNL----FSDPGFKDGGFTSRDPWVRAYAFRKSLETMDLGAELGAEIYVVWPGRATGKARKVWDWVREPLNFMAAYAEDQGYRFALEPKPATVGSMLALIHTLERPRFGLNPEFAHETMAG-LNFVHAVAQALDAGKLLHIDL-----NGQRMNRFDQDLRFGSENLKAFLLVDLLESSGYQGPRHFDAH--ALRTEDEEGVWAFARGCMRTYLILKE. 314
29 -39.8001gw9_A mol:protein length:388 XYLOSE ISOMERASE  ali model follow..  16  25...........PFGDATRRALDPVESVQRLAELGAHGVTFHDDDLISEREEHVKRFRQALDDTGMKVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIEPPTVGHALAFIERLERPEYGVNPEVGHEQMAG-LNFPHGIAQALWAGKLFHIDL-----NGQNGIKYDQDLRFGAGDLRAFWLVDLLESAGYSGPRHFDFPRTEDFDGVWASAAGCMRNYLILKERAAA. 319
30 -39.8001muw_A mol:protein length:386 XYLOSE ISOMERASE  ali model follow..  15  24...........PFGDATRPALDPVETVQRLAELGAHGVTFHDDDSDTERESHIKRFRQALDATGMTVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAKTYVAWGGREAKDVRVALDRMKEAFDLLGEYVTSQGYDIRFAIEPPTVGHALAFIERLERPEYGVNPEVGHEQMAG-LNFPHGIAQALWAGKLFHIDL-----NGQSGIKYDQDLRFGAGDLAAFWLVDLLESAGYEGPRHFDFK--PPRTEDIDGVWASAAGCMRNYLILKE. 314
31 -39.7006xia_A mol:protein length:387 D-XYLOSE ISOMERASE  ali model follow..  14  11TFGLWTVGWE-PFGDATRTALDPVESVRRLAELGAHGVTFHDDDLIPFRYEHVKRFRQALDDTGMKVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIEPKTVGHALAFIERLERPEYGVNPEVGHEQMAG-LNFPHGIAQALWKLFHIDLNG-------QNGIKYDQDLRFGAGDLAAFWLVDLLESAGYSGPRHFDFK--PPRTEDFDGVWASAAGCMRNYLILKE. 314
32 -39.5004E3V Entity 1(prereleased)  ali follow..  16  25...........PFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPFREEHVKRFRQALDDTGMKVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPPTVGHALAFIERLERPEYGVNPEVGHEQMAG-LNFPHGIAQALWAGKLFHIDL-----NGQNGIKYDQDLRFGAGDLRAFWLVDLLESAGYSGPRHFDFPRTEDFDGVWASAAGCMRNYLILKERAAA. 319
33 -39.4001bxb_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  15  1...MYEPKPEHRFTF-VRERLDPVYVVHKLAELGAYGVNLHDEDPPQERDQIVRRFKKALDETGLKVPMVTANL----FSDPAFKDGAFTSPDPWVRAYALRKSLETMDLGAELGAEIYVVWPGRATGKARKVWDWVREALNFMAAYAEDQGYRFALEPKPATVGSMLAFIHTLDRPRFGLNPEFAHETMAG-LNFVHAVAQALDKLFHIDLND-------QRMSRFDQDLRFGSENLKAFFLVDLLESSGYQGPRHFDAH--ALRTEDEEGVWAFARGCMRTYLILKE. 314
34 -38.8001tz9_A mol:protein length:367 Mannonate dehydratase  ali model follow..  12  1......MGSHMKWGFRWYGAAGDAIPLKHIRQIGITGVVGTLLNGDVWTVAEIQALKQSVEQEGLALLGIESVAIHDAI-----------KAGTDQRDHYIDNYRQTLRNLGKCGISLVCYKAMYAGVTEEDLVENLRYFLERVIPVCEEENIKMGIHPDDKNLADLKRILSLVDSPANGITFCTGSLGADPTNDLPTMIREIGHRINFVHFRNVKYLG---EHRFEETAHPSVAGSLDMAELMQALVDVGYEGVIRPDHGEKAMPGYGLYDRAMGLTYIQGLYEATKA. 356
35 -38.6001dxi_A mol:protein length:388 D-XYLOSE ISOMERASE  ali model follow..  15  12TFGLWTVGWQ-PFGDATRPALDPVETVQRLAELGAYGVTFHDDDLITERESHIKRFRQALDATGMTVPMATTNL----FTHPVFKDGGFTANDRDVRRYALRKTIGNIDLAAELGAKTYVAWGGREAKDVRDALDRMKEAFDLLGEYVTAQGLRFAIEPKPPTVGHALAFIERLERPEYGVNPEVGHEQMAG-LNFPHGIAQALWKLFHIDLNG-------QSGIKYDQDLRFGAGDLAAFWLVDLLETAGYEGPRHFDFK--PPRTEDFDGVWASAAGCMRNYLIL... 313
36 -38.3003ban_A mol:protein length:386 D-mannonate dehydratase  ali model follow..  12  59.....................NILELKKMVEEAGLEITVIESIPVHE-LIENYKTSIRNVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGSTSLAFLKSDLAGVDPVADDLNLPGWDSSIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDDTGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYALNRINFMHTRNVTAGAWGFQE----TAHLSQAGDIDMNAVVKLLVDYDWQGSLRPDHDQTKTPGYGLYDRALGATYFNGLYEANMR. 360
37 -38.0001bhw_A mol:protein length:393 XYLOSE ISOMERASE  ali model follow..  13  24...........AFGDATRTALDPVEAVHKLAEIGAYGITFHDDDDAQTRDGIIAGFKKALDETGLIVPMVTTNL----FTHPVFKDGGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREAKDVSAALDRYREALNLLAQYSEDRGYRFAIEPKPPTAGHAIAFVQELERPEFGINPETGNEQMSN-LNFTQGIAQALWHKKLFHIDL-----NGQHGPKFDQDLVFGHGDLLNAFSLVDLGAPAYDGPRHFDYK--PSRTEDYDGVWESAKANIRMYLLLKE. 319
38 -36.6003ayt_A mol:protein length:254 Putative uncharacterized protein TTHB071  ali model follow..  17  1..........MDVRLAFPLS-RAEEALPRLQALGLG-AEVYL---DPALLEEDALFQSLRRRFSGKLSV-----------HLPFWNLDLLSPDPEVRGLTLRRLLFGLDRAAELGADRAVFHSGIPPEEALERALPLAEALGLVVRRARTLGVRLLLENSHEPHPEALRPVLEAHAGELGFCFDAAHARVFSRTP--DPGPWLALAPEHLHLND--------TDGVYDRHWNLGRGVLGHGAWLRPYL----DRTMVLEV---------REDPEASLAFLQALAGE.... 241
39 -36.0001did_A mol:protein length:394 D-XYLOSE ISOMERASE  ali model follow..  13  24...........PFGVATRKNLDPVEAVHKLAELGAYGITFHDNDTEAEREKILGDFNQALKDTGLKVPMVTTNL----FSHPVFKDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGRGSKDLAAALDRMREGVDTAAGYIKDKGLRIALEPKPPTVGHGLAFIEQLEHGDVGLNPETGHEQMAG-LNFTHGIAQALEKLFHIDLNG-------QRGIKYDQDLVFGHGDVDLLENGFPNGGPKYTGPRHFDYK--PSRTDGYDGVWDSAKANMSMYLLLKE. 320
40 -28.9002hcv_A mol:protein length:438 L-rhamnose isomerase  ali model follow..  11  42..AVTAKVEKFFVAVGTGEPRGIFDKLDDCAVIQLTRATPNVSLHIPWDKADPKELKARGDALGLGFDAMNSNTFSDAPGQAHSYKYSLSHTNAATRAQAVEHNLECIEIGKAIGSKALTVWIG-GQSNFTRAFERYLSAMAEIYKGLPD-DWKLFSEHKMYEPAGTNYLIAQTLGPKAQCLVDLGHHAPNTNIEMIVARLIQFGKLGGFHFNDSKYGDDD---------LDAGAIEYRLFLVFNELVDAEARGVKGFHIDQSHNVTDPIESLINSANEIRRAYAQA... 353
41 -25.4001a0e_A mol:protein length:443 XYLOSE ISOMERASE  ali model follow..  76................DKAFARVDALFEFCEKLNIEYFCFHDRDTNKILDKVVERIKERMKDSNVKLLWGTANL----FSHPRYMHGAATTCSADVFAYAAAQVKKALEITKELGGEGYVFWGGRLNTDLGFELENLARFLRMAVDYAKRIGGQFLIEPKPKDVATAYAFLKSHGLDEFKFNIEANHATLAGHTQHELRMARILGKLGSIDANQGDLLLGWDT-------DQFPTNVYDTTLAMYEVIKAGTKGGLNFDAKVRRASYKVEDLFIGHIAGMDTFALGF... 366
42 -25.3001a0d_A mol:protein length:440 XYLOSE ISOMERASE  ali model follow..  10  71.............SGMDLAKARVEAAFEFFEKLNIPFFCFHDVDTYKNLDIIVDMIEEYMKTSKTKLLWNTANL----FTHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGAENYVFWGGRLNTDMKLELDNLARFLHMAVDYAKEIGGQFLIEPKPKDVATALAFLQTYGLKDFKFNIEANHATLAG-HTFEHELRVARIHLGSVDANQ-------GDMLLGWDTDEFPTDLYSTTLAMYEILKNGGRGGLNFDAKVRRGSFEPEDLFYAHIAGMDSFAVGL... 364
43 -24.2001a0c_A mol:protein length:438 XYLOSE ISOMERASE  ali model follow..  10  75...............MDIAKARVEAAFEFFDKINAPYFCFHDRDTNKNLDTIVAMIKDYLKTSKTKVLWGTANL----FSNPRFVHGASTSCNADVFAYSAAQVKKALEITKELGGENYVFWGGRLNTDMEFELDNFARFLHMAVDYAKEIGGQFLIEPKPKDVANVLAFLRKYDLDKFKVNIEANHATLAF-HDFQHELRYARINLGSIDANT------GDMLLGWDTDQFPTDIRMTTLAMYEVIKMGGDKGGLNFDAKVRRASFEPEDLFLGHIAGMDAFAKGF... 366
44 -22.4002x7v_A mol:protein length:287 PROBABLE ENDONUCLEASE 4  ali model follow..  14  1.........MIKIGAHMPISKGFDRVPQDTVNIGGNSFQIFPHNARSPSDEAATKFKREMKKHGIDWENAFCH---------SGYLINLASPKDDIWQKSVELLKKEVEICRKLGIRYLNIHPGHLGTGEEEGIDRIVRGLNEVLN--NTEGVVILLENVSQKGEQLKKIRDLVDRDRVAITYDTCHGFDSGYEGVEALLNEIEERLKMIHLNDSK----YPLGAAKDRHERIGSGFIGEEGFAVFFSFKEIQEPWILETPGGNEE-------AEDIKKVFEIIEKFGI. 284
45 -21.5001qtw_A mol:protein length:285 ENDONUCLEASE IV  ali model follow..  16  1.........MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQLTTQTIDEFKAACEKYHYTSAQILPH---------DSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHQISEEDCLARIAESINIALD--KTQGVTAVIENTAGQGEHLAAIIDGVEKSRVGVCIDTCHAFAAGYAECEKTFADFAKYLRGMHLNDAK----STFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGPLILE-------TINPDIWAEEIAWLKAQQTE.... 281
46 -21.0003bww_A mol:protein length:307 Protein of unknown function DUF692/COG3220  ali model follow..  10  1.......GMRQGAGLGYRRDL-AEGFLQLRNNDRIQFMEIAPENWIKMGGFARYQFDKVAEKIPILIHGLSLSLGGQA-------------------PLDKELLSSIKAMIKQYNTPFFSDHLSFCECPMPFTDEAVKHTAARIREVQDFLEIQISVENTSSTMNEVEFLNAIVQEANCGIHLDVNNIYVHGLLDPHVFIDNVLKRVNYIHIAG------HDDEHAATEVQIQTSESFNKIKGDYTYARLSHMPPTLLERDFN---FPPFEKLCKEVDIIHQLQQKYVK. 298
47 -20.7003aal_A mol:protein length:303 Probable endonuclease 4  ali model follow..  18  1.....GLNHMLKIGVSMSGKKMLLAASEEAASYGANTFMIYTGAPQNIEELNIEAGRQHMQAHGIE----------EIVVHAPYIINIGNTTNLDTFSLGVDFLRAEIERTEAIGAKQLVLHPGHVGAGVEAGLRQIIRGLNEVLT--REQNVQIALETMAGKGEELAYIIDGVANDKLSVCFDTCHTHDAGYDDFDGVLEEFDGRLKVLHINDSK----NPRGSRKDRHENIGFGHIGFAALNYIVHHPQLEDPKILETYVGEDKNNKKPPYKHEIAMLRAQSFD.... 291
48 -20.0003aam_A mol:protein length:270 Endonuclease IV  ali model follow..  16  1.........MPRYGLSIAGKKGVAGAVEEATALGLTAFQIFAKSPRSLSPAEVEAFRALREASGGLPAVIHASY------------LVNLGAEGELWEKSVASLADDLEKAALLGVEYVVVHPGGRPERVKEGALKALRLAGVRSR------PVLLVENTAGGGEKVEELAWLVADTPLQVCLDTCHAYAAGYDDPLGVLDALDERVPVVHLNDSV----GGLGSRVDHHAHLLQGKIGE-GLKRVFLDPRLKDVFILETPRGPEE-------AWNLRVFRAWLEEA... 270
49 -19.0001xp3_A mol:protein length:307 endonuclease IV  ali model follow..  16  2.......SSMLKIGVSMSGKKMLLAASEEAVSYGATTFMIYTGAPQNIEELNIEAGRKHMEQNGIE----------EIIIHAPYIINVGNTTKPETFQLGVDFLRMEIERTSALGVAKQIVLGAHVGAGADAGIQQIIKGLNEVLT--PDQTVNIALETMAGKGEEIAKIIDGVKNEKLSVCFDTCHTHDAGYDIVNNFDGVLNDRLQVLHINDSK----NVRGAGKDRHENIGFGHIGYKALHHIVHHPQLTHPKILETYVGEDKKDKKPPYKLEIEMLKNGTFD.... 291
50 -18.2002j6v_A mol:protein length:301 UV ENDONUCLEASE  ali model follow..  10  31TLRLAHLTEERVREKAAENLRDLERILRFNADHGFALFRIGQHDWEGAYEEELARLGALARAFGQRLSM------------HPGQYVNPGSPDPEVVERSLAELRYSARLLSLLGAEVLVLHLGGAYGEKGKALRRFVENLRGEEEVLRYLALE-----NDERLWNVEEVLKAAEALGVPVVVDTLHHALNPGREALRLAFPTWRGRPKVHLASQDPKKRPGAHAFR----------VTREDWERLLSALPGPADVMVEAKGKEQGLAT..................... 290
51 -17.1003UVA Entity 1(prereleased)  ali follow..  69.....................TPEELRMDLEKAGKHRVNLHA-ERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKD----GLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCYKDTPSDRLTPRKRLKESLDQIFAAEINEANLDAVESKLFGIGSES-YLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSD---------HVVTFDD-ELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFA... 351
52 -16.6003p14_A mol:protein length:424 L-rhamnose isomerase  ali model follow..  69.....................TPEELRMDLEKAGKHRVNLHA-ERDQLEPRHFEKWVRWAKRHGLGLDFNPTLFSHEKAKD----GLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCYKDTPSDRLTPRKRLKESLDQIFAAEINEANLDAVESKLFGIGSES-YLSYALKNDKLCLLDTGHYHPTETVSNKISAMLLFHDKLALHVSRPVRWDSD---------HVVTFDD-ELREIALEIVRNDALDRVLIGLDFFDASINRIAAWTIGTRNVIKALLFA... 351
53 -14.1001d8w_A mol:protein length:426 L-RHAMNOSE ISOMERASE  ali model follow..  72.....................NASELRADLEQAGPKRLNLHAVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADG-----TLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSMKDITVDRLAPRQRLLAALDEVISKLNPAHHIDAVEAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDH-------------LDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRA... 353
54 -9.2702egz_A mol:protein length:219 3-dehydroquinate dehydratase  ali model follow..  10  1..........MLIAV-PLDDTNFSENLKKAKEKGADIVELRVDQFSDTSLNYVKEKLEEVHSQGLKILTIRSPEEGGREVKNREELFEELSPLSDYTDIELGLLVKLYNITKEAGKKLIISYHNFELTPPNWIIREVLREGYRYGGIPK----IAVKANSYEDVARLLCISRQVEGEKILISMGDYGKISR---------YVFGSVITYCSLEKAF-----------------APGQIPLEEMVELRKKFY....................................... 217
55 -9.1502c0h_A mol:protein length:353 MANNAN ENDO-1,4-BETA-MANNOSIDASE  ali model follow..  10  25NQAWVNYARDFGHNQYSKGKSTFESTLSDMQSHGGNSVRVWLHIEGESTPEFDNN------------------------------------YVTGIDNTLISDMRAYLHAAQRHNILIFFTLWNGAVKDTRKLQSYIDHALKPMANALKNEKALGGWDIMNESAQEIGRFVNWQAAAIKEV--DPGAMVTVGSWNMKADTDAMGFHFYQVHTGNESPFKHSFSNFRLKKPMVIGEAGMSSESMFEWAYTKGYSGAWT................................. 322
56 -9.0901v77_A mol:protein length:212 hypothetical protein PH1877  ali model follow..  16.......................DKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNV-ALGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLIS---------LGVVIGMEIPQAKASISMYPEIIL.................................................................................. 207

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.