current user: public




Query: 3trx_A mol:protein length:105 THIOREDOXIN, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINELVLast
1 -71.5003trx_A mol:protein length:105 THIOREDOXIN  ali model  100  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCTPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
2 -71.5001erv_A mol:protein length:105 THIOREDOXIN  ali model follow..  98  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
3 -71.5003e3e_A mol:protein length:105 Thioredoxin  ali model follow..  97  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKRMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
4 -71.4001cqg_A mol:protein length:105 THIOREDOXIN  ali model follow..  96  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
5 -71.4001aiu_A mol:protein length:105 THIOREDOXIN  ali model follow..  98  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
6 -71.4001erw_A mol:protein length:105 THIOREDOXIN  ali model follow..  97  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWSGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
7 -71.4003kd0_A mol:protein length:105 Thioredoxin  ali model follow..  95  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDSQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105
8 -69.8003qfa_C mol:protein length:116 Thioredoxin  ali model follow..  97  7.VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPSKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV 110
9 -69.7001gh2_A mol:protein length:107 THIOREDOXIN-LIKE PROTEIN  ali model follow..  41  2GVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFQFFRNKVRIDQYQGADAVGLEEKIKQHL 106
10 -69.7003ZZX Entity 1(prereleased)  ali follow..  50  1MVYQVKDQEDFTKQLNEAGNKLVVIDFYATWCGPCKMIAPKLEELSQSMSDVVFLKVDVDECEDIAQDNQIACMPTFLFMKNGQKLDSLSGANYDKLLELVEKN. 104
11 -67.3001xwa_A mol:protein length:111 thioredoxin  ali model follow..  49  6MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFDNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 111
12 -67.1002vim_A mol:protein length:104 THIOREDOXIN  ali model follow..  36  1.MRVLATAADLEKLINENKGRLIVVDFFAQWCGPCRNIAPKVEALAKEIPEVEFAKVDVDQNEEAAAKYSVTAMPTFVFIKDGKEVDRFSGANETKLRETITRH. 103
13 -65.7002xbi_A mol:protein length:108 THIOREDOXIN  ali model follow..  42  6.LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 108
14 -65.2002xbq_A mol:protein length:117 THIOREDOXIN  ali model follow..  42  15.LIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKY-DAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI 117
15 -65.0003f3q_A mol:protein length:109 Thioredoxin-1  ali model follow..  45  1MVTQFKTASEFDSAIAQ--DKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAAN. 102
16 -64.6001m7t_A mol:protein length:107 Chimera of Human and E. coli thioredoxin  ali model follow..  70  1MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 106
17 -64.2002vm1_A mol:protein length:118 THIOREDOXIN H ISOFORM 1.  ali model follow..  39  8.VIACHTKQEFDTHMANGTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALM 113
18 -64.1001syr_A mol:protein length:112 thioredoxin  ali model follow..  37  3MVKIVTSQAEFDSIISQ--NELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEVSEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYA 105
19 -64.1002diy_A mol:protein length:130 Thioredoxin-like protein 2  ali model follow..  26  20.VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 123
20 -63.8001xfl_A mol:protein length:124 Thioredoxin h1  ali model follow..  42  12.VIACHTVETWNEQLQKASKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHL 117
21 -63.6001ti3_A mol:protein length:113 thioredoxin H  ali model follow..  41  6.VIACHTVDTWKEHFEKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHA 111
22 -63.4001ep7_A mol:protein length:112 THIOREDOXIN CH1, H-TYPE  ali model follow..  45  4.VIVIDSKAAWDAQLAKGEHKPIVVDFTATWCGPCKMIAPLFETLSNDYGKVIFLKVDVDAVAAVAEAAGITAMPTFHVYKDGVKADDLVGASQDKLKALVAKHA 110
23 -62.8001wmj_A mol:protein length:130 Thioredoxin H-type  ali model follow..  38  15VVIACHNKDEFDAQMTKAAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHV 121
24 -62.7002oe0_A mol:protein length:114 Thioredoxin-3  ali model follow..  41  8.ITKLTNLTEFRNLIKQ--NDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL. 108
25 -62.7002fa4_A mol:protein length:111 Thioredoxin II  ali model follow..  46  2MVTQLKSASEYDSALASG-DKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 105
26 -62.6002wz9_A mol:protein length:153 GLUTAREDOXIN-3  ali model follow..  26  14.VEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 117
27 -62.2002iwt_A mol:protein length:125 THIOREDOXIN H ISOFORM 2  ali model follow..  37  17.VISVHSLEQWTMQIEEAAKKLVVIDFTASWCGPSRIMAPVFADLAKKFPNAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTAKVGLHA 122
28 -61.8001r26_A mol:protein length:125 Thioredoxin  ali model follow..  31  15.VVDVYSVEQFRNIMSE--DILTVAWFTAVWCGPCKTIERPMEKIAYEFPTVKFAKVDADNNSEIVSKCRVLQLPTFIIARSGKMLGHVIGANPGMLRQKLRDII 116
29 -61.7001faa_A mol:protein length:124 THIOREDOXIN F  ali model follow..  39  24......NKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAAR 123
30 -61.1002j23_A mol:protein length:121 THIOREDOXIN  ali model follow..  45  11.VQVISSYDQFKQVTG--GDKVVVIDFWATWCGPCKMIGPVFEKISDTPDKVGFYKVDVDEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHS 114
31 -61.0003cxg_A mol:protein length:133 Putative thioredoxin  ali model follow..  23  15IYIELKNTGSLNQVFSSTQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYY-YVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNVHTVEGANQNDIEKAFQKYC 122
32 -60.9003d21_A mol:protein length:139 Thioredoxin H-type  ali model follow..  42  26.VHLITTKERWDQKLSEADGKIVLANFSARWCGPCKQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
33 -60.9003d22_A mol:protein length:139 Thioredoxin H-type  ali model follow..  40  26.VHLITTKERWDQKLSEADGKIVLANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSDFSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAIL 131
34 -60.3003d6i_A mol:protein length:112 Monothiol glutaredoxin-3  ali model follow..  31  2.VIEINDQEQFTYLTTTAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCK 108
35 -56.6002f51_A mol:protein length:118 thioredoxin  ali model follow..  32  5IVHFNGTHEALLNRIKEA-PGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEKTLDQFVGADVSRIKADIEKF. 111
36 -56.5003hhv_A mol:protein length:110 Thioredoxin (TrxA-2)  ali model follow..  33  12......NSKNFDEFITK--NKIVVVDFWAEWCAPCLILAPVIEELANDYPQVAFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAPREEIEVRLKSLL 109
37 -56.0002e0q_A mol:protein length:104 thioredoxin  ali model follow..  35  5......DSKNFDSFLAS--HEIAVVDFWAEWCAPCLILAPIIEELAEDYPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAPREEIEIRIKNLL 102
38 -53.7003tco_A mol:protein length:109 Thioredoxin (TrxA-1)  ali model follow..  34  10......TEENFDEVIRN--NKLVLVDCWAEWCAPCHLYEPIYKKVAEKYGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGADEDTLESTVNKYL 108
39 -53.7002o7k_A mol:protein length:107 Thioredoxin  ali model follow..  34  4MAIVKVTDADFDSKVESG---VQLVDFWATWCGPCKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL 107
40 -53.6002o89_A mol:protein length:107 Thioredoxin  ali model follow..  32  4MAIVKVTDADFDSKVESG---VQLVDFWATWCGTSKMIAPVLEELAADYGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFPKENLAEVLDKHL 107
41 -53.5002cvk_A mol:protein length:110 Thioredoxin  ali model follow..  34  8......TDQNFDETLGQ--HPLVLVDFWAEWCAPCRMIAPILEEIAKEYGKLLVAKLDVDENPKTAMRYRVMSIPTVILFKDGQPVEVLVGAPKRNYQAKIEKHL 106
42 -53.4001dby_A mol:protein length:107 CHLOROPLAST THIOREDOXIN M CH2  ali model follow..  28  1MEAGAVNDDTFKNVVLES-SVPVLVDFWAPWCGPCRIIAPVVDEIAGEYDKLKCVKLNTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGAPKATIVQTVEKYL 106
43 -53.3002voc_A mol:protein length:112 THIOREDOXIN  ali model follow..  29  1MAIVKATDQSFSAET---SEGVVLADFWAPWCGPSKMIAPVLEELDQEMDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFPKEALQELVNKHL 104
44 -53.2003gnj_A mol:protein length:111 Thioredoxin domain protein  ali model follow..  22  4MSLEKLDTNTFEQLIYDE-GKACLVMFSRKNCHVCQKVTPVLEELRLNYESFGFYYVDVEEEKTLFQRFSLKGVPQILYFKDGEYKGKMAGDEDDEVEQMIADVL 109
45 -52.8001nsw_A mol:protein length:105 THIOREDOXIN  ali model follow..  33  6......TDANFQQAIQG--DGPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYPKEQLEAQLADVL 104
46 -52.8003dyr_A mol:protein length:111 Thioredoxin-1  ali model follow..  29  9......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGTPTLLLFKNGEVAATKVGASKGQLKEFLDANL 108
47 -52.7001nw2_A mol:protein length:105 THIOREDOXIN  ali model follow..  34  6......TDANFQQAIQG--DKPVLVDFWAAWCGPCRMMAPVLEEFAEAHDKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGEPVKQLIGYPKEQLEAQLADVL 104
48 -52.7002i1u_A mol:protein length:121 Thioredoxin  ali model follow..  33  18......TDASFATDVLSS-NKPVLVDFWATWCGPCKMVAPVLEEIATERTDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAGKAALLRELSDVV 117
49 -52.6001srx_A mol:protein length:108 THIOREDOXIN  ali model follow..  29  8......TDDSFDTDLVKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYIERGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
50 -52.6002eir_A mol:protein length:108 Thioredoxin 1  ali model follow..  28  8......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKCFLDCNL 107
51 -52.5001t00_A mol:protein length:112 Thioredoxin  ali model follow..  25  11......TDDSFEQDVLKN-DKPVLVDFWAAWCGPCRQIAPSLEAIAAEYDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAPKAAIVRDLEDFI 110
52 -52.5002puk_C mol:protein length:106 Thioredoxin M-type, chloroplast (TRX-M)  ali model follow..  28  6......NDSSWKEFVLES-EVPVMVDFWAPWCGPSKLIAPVIDELAKEYGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAPKSTLTDSIEKYL 105
53 -52.5001thx_A mol:protein length:115 THIOREDOXIN  ali model follow..  22  13......TDAEFESEVLKA-EQPVLVYFWASWCGPCQLMSPLINLAANTYDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVSKDKLLSFLDTHL 112
54 -52.5001keb_A mol:protein length:108 Thioredoxin 1  ali model follow..  26  8......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKLIASILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
55 -52.4001uvz_A mol:protein length:119 THIOREDOXIN  ali model follow..  36  7TTFNIQDGPDFQDRVVNS-ETPVVVDFHAQWCGPCKILGPRLEKMVAKQGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIDEDQLEAFLKKLI 112
56 -52.3003VFI Entity 1(prereleased)  ali follow..  27  5......SDSDFQLEVRQH-PDPIIIMFTGSWCQPCKKMKPTFEEMASQMGDIRFAYMDAEDAEKTMAELNIRTLPSLALFVDGMIREVFSGTNKSDLRYWINNNI 104
57 -52.3002l6c_A mol:protein length:110 Thioredoxin  ali model follow..  21  1.MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIRDGKVAKVFSGINPRELQALYASI. 104
58 -52.3001txx_A mol:protein length:108 PROTEIN (THIOREDOXIN)  ali model follow..  26  8......TDDSFDTDVLKA-DGAILVDFWAEWCVWCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
59 -52.2001zcp_A mol:protein length:108 Thioredoxin 1  ali model follow..  25  8......TDDSFDTDVLKA-DGAILVDFWAEWCACAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 107
60 -52.2002o8v_B mol:protein length:128 Thioredoxin 1  ali model follow..  27  22......TDDSFDTDVLKA-DGAILVDFWAEWCGPAKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 121
61 -52.0003emx_A mol:protein length:135 Thioredoxin  ali model follow..  18  23...........PEEFRQLLQGDAILAVYSKTCPHCHRDWPQLIQASKEVDGSLIGERELSAARLEMNKAGVEGTPTLVFYKEGRIVDKLVGAPWSLKVEKAREIY 125
62 -52.0002i4a_A mol:protein length:107 thioredoxin  ali model follow..  31  8......SDSSFDQDVLKA-SGLVLVDFWAEWCGPCKMIGPALGEIGKEFGKVTVAKVNIDDNPETPNAYQVRSIPTLMLVRDGKVIDKKVGAPKSQLKAWVESA. 106
63 -51.9003hxs_A mol:protein length:141 Thioredoxin  ali model follow..  31  35...KIADYENHSKEWKYLGDKPAIVDFYADWCGPCKMVAPILEELSKEYGKIYIYKVNVDKEPELARDFGIQSIPTIWFVPMKGEPQVNMGASKEQLKGYIDKVL 138
64 -51.6002l5l_A mol:protein length:136 Thioredoxin  ali model follow..  28  20LAKVYNFEKNPEEWKYEG-DKPAIVDFYADWCGPCKMVAPILDELAKEYGQIVIYKVDTEKEQELAGAFGIRSIPSILFIPMEGKPEMAQGAPKASFKKAIDEFL 125
65 -51.5003hz4_A mol:protein length:140 Thioredoxin  ali model follow..  26  12......EDMTWSQQVEDS-KKPVVVMFYSPACPYCKAMEPYFEEYAKEYSSAVFGRINIATNPWTAEKYGVQGTPTFKFFCHGRPVWEQVGQYPSILKNAVRDML 111
66 -51.3003ul3_B mol:protein length:128 Thioredoxin  ali model follow..  21  24VPRLQQNGSNIINGVNMK-NTVIVLYFFAKWCQACTMQSTEMDKLQKYYKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFSSNDLIALIKKH. 128
67 -50.7002dj0_A mol:protein length:137 Thioredoxin-related transmembrane protein 2  ali model follow..  27  13......NDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYTGLNFGKVDVGRYTDVSTRYKVKQLPTLILFQGGKEAMRRPQIDKKG......... 110
68 -48.9002av4_A mol:protein length:160 Thioredoxin-like protein 4A (DIM1)  ali model follow..  18  16MLQHLNSGWAVDQAIVNEDERLVCIRFGHDYDPDCMKMDELLYKVADDIKNCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTNNNKINWPMNN.. 120
69 -47.7001oaz_A mol:protein length:123 THIOREDOXIN 1  ali model follow..  28  9......TDDSFDTDVLKA-DGAILVDFWAEWCGPCKMIAPILDEIADEYGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGASKGQLKEFLDANL 122
70 -47.4001qgv_A mol:protein length:142 SPLICEOSOMAL PROTEIN U5-15KD  ali model follow..  21  4MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTNNNKINWAMEDK. 109
71 -47.4003p2a_A mol:protein length:148 Putative thioredoxin-like protein  ali model follow..  23  44......TAETLDKLLQD--DLPMVIDFWAPWCGPCRSFAPIFAETAAERGKVRFVKVNTEAEPALSTRFRIRSIPTIMLYRNGKMIDMLNGAPKAPFDNWLDEQL 142
72 -46.6001v98_A mol:protein length:140 thioredoxin  ali model follow..  28  39......DEKGFAQEVAGAP--LTLVDFFAPWCGPCRLVSPILEELARDHGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATWVGAPRRVLEERLRPYL 137
73 -45.6002l57_A mol:protein length:126 Uncharacterized protein  ali model follow..  19  7KQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKERENIYYARLEEEKNIDLAYKYDANIVPTTVFLKEGNKFYVHQGLRKNNIETILNSLG 116
74 -45.6002ppt_A mol:protein length:155 thioredoxin-2  ali model follow..  25  52......IDPAILARAERD-DLPLLVDFWAPWCGPCRQMAPQFQAAAATLGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGAPASELVGFVRGKL 151
75 -45.0003aps_A mol:protein length:122 DnaJ homolog subfamily C member 10  ali model follow..  22  9......TPQTFNEKVLQG-KTHWVVDFYAPWCGPCQNFAPEFELLARMIGKVRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEDAKTIAALIYGKL 112

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.