current user: public

Query: 3sb2_A mol:protein length:79 Protein hfq, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
6 -50.8001kq1_A mol:protein length:77 Host Factor for Q beta  ali model follow..  30  1.MIANENIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNQGKQHLIYKHAISTYTVETEGQASTESEE.. 77
7 -49.0003ahu_A mol:protein length:78 Protein hfq  ali model follow..  47  5.SMKPINIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLEEGKQQLIYKHAISTFAPQKNVQLELE..... 78
8 -44.0002qtx_A mol:protein length:71 Uncharacterized protein MJ1435  ali model follow..  25  6KKQQPKKVIPNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKGDRNLLVFKHAIDYIE............... 70
9 -37.2003hfo_A mol:protein length:70 Ssr3341 protein  ali model follow..  29  2......SRFDSGLPSVRKDQTPVEIKLLTGDSLFGTIRWQDTDGLGLVDDSERIVRLAAIAYITPRR............ 70
10 -36.7003hfn_A mol:protein length:72 Asl2047 protein  ali model follow..  29  2....AITEFDTSLPSIRKQAAPVEIKLVTGDAITGRVLWQDPTCVCIADSRQTTIWKQAIAYLQPK............. 71
11 -11.0001b34_B mol:protein length:118 PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D  ali model follow..  29  31...........VLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMW........................ 74
12 -11.0003bw1_A mol:protein length:96 U6 snRNA-associated Sm-like protein LSm3  ali model follow..  22  1MMETPLDLLKLNLDE------RVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIY....................... 50
13 -10.8003swn_A mol:protein length:82 U6 snRNA-associated Sm-like protein LSm5  ali model follow..  14  1MGMSMTILPLELIDKCIGSN--LWVIMKSEREFAGTLVGFDDYVNIVLKDVTELLNGNGMCMLIPGGKPE......... 82
14 -10.6001i81_A mol:protein length:83 PUTATIVE SNRNP SM-LIKE PROTEIN  ali model follow..  27  27.....................PVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELIRGDNIVYISP.............. 83
15 -10.3001m5q_A mol:protein length:130 small nuclear ribonucleoprotein homolog  ali model follow..  17  12.....................EVQVVLSNGEVYKGVLHAVDNQLIVLANASNKAGEKFNRVFIMYRYIVHIDSTERRID 70
16 -10.0001i8f_A mol:protein length:81 PUTATIVE SNRNP SM-LIKE PROTEIN  ali model follow..  29  23.....................QVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEII........................ 56
17 -9.9101i4k_A mol:protein length:77 PUTATIVE SNRNP SM-LIKE PROTEIN  ali model follow..  17  1MPPRPLDVLNRSLKS------PVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQNGEVVRKV................ 57
18 -9.9001th7_A mol:protein length:81 Small nuclear riboprotein protein  ali model follow..  15  19...................NNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGKKL................ 62
19 -9.8802y9a_E mol:protein length:92 SMALL NUCLEAR RIBONUCLEOPROTEIN E  ali model follow..  21  30...................RIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSK...................... 67
20 -9.5902y9a_G mol:protein length:76 SMALL NUCLEAR RIBONUCLEOPROTEIN G  ali model follow..  26  16.....................KLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMA........................ 49
21 -9.5101loj_A mol:protein length:87 small nuclear ribonucleoprotein homolog (Sm-l  ali model follow..  23  25.....................PVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRL................ 66
22 -9.4801m8v_A mol:protein length:77 PUTATIVE SNRNP SM-LIKE PROTEIN  ali model follow..  11  18.....................DVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQDGEVVKRY................ 59
23 -9.3003swn_C mol:protein length:117 U6 snRNA-associated Sm-like protein LSm7  ali model follow..  20  39.....................RIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLR....................... 73
24 -9.1303pgg_A mol:protein length:121 U6 snRNA-associated Sm-like protein LSm5. SM  ali model follow..  16  38...................GNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYG........................ 73
25 -9.0203swn_B mol:protein length:77 U6 snRNA-associated Sm-like protein LSm6  ali model follow..  26  18.....................KVLIRLSSGVDYKGILSCLDGYMNLALERTEEYV........................ 51

FFAS is supported by the NIH grant R01-GM087218-01
8 0 2 2 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li Z, Ye Y, Godzik A. Flexible Structural Neighborhood--a database of protein structural similarities and alignments. Nucleic Acids Res. 2006 Jan 1;34(Database issue):D277-80.