current user: public




Query: 3s2w_A mol:protein length:159 Transcriptional regulator, MarR family, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst SNAMNTTEFDGISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDEKDRRSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIMLast
1 -65.3003s2w_A mol:protein length:159 Transcriptional regulator, MarR family  ali model  100  1SNAMNTTEFDGISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDEKDRRSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIM 159
2 -56.3003bpx_A mol:protein length:148 Transcriptional regulator  ali model follow..  25  2...............SHMDRDIPLKGLLSIILRSHRVFIGRELGHLNLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYILEVTRRGEEIIPLILKVEERWEDLLFRDFTEDERKLFRKMCRRLAEEAVRM. 144
3 -56.1001lj9_A mol:protein length:144 transcriptional regulator SlyA  ali model follow..  24  1.....................TDILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVALQGLSEVEISQLADYLVRMRKNVSE.. 136
4 -56.0003cjn_A mol:protein length:162 Transcriptional regulator, MarR family  ali model follow..  19  3AMAESTDQTEQLRELAEIGLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDSDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLANIRV.. 159
5 -55.9003k0l_A mol:protein length:162 Repressor protein  ali model follow..  16  1....SNAMLRSSSVDRKREEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLSTF. 154
6 -55.2003e6m_A mol:protein length:161 MarR family Transcriptional regulator  ali model follow..  16  5.TEARKIPKPSFPYGSPGELNSFLPYLLTRITHIWSSELNQALASEKLPTPKLRLLSSLSAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQRKRTVVLTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILKGKTD.. 160
7 -55.1003oop_A mol:protein length:143 Lin2960 protein  ali model follow..  18  1.............SNAMRGYYDEISFDVNTTAKKMHLFLMRSIASYDVTPEQWSVLEGIEANEPISQKEIALWTKKDTPTVNRIVDVLLRKELIVREISTEDRRISLLSLTDKGRKETTELRDIVEASCEKMFAGVTRTDLEQFTAILKNISTNIE... 143
8 -53.9003bj6_A mol:protein length:152 Transcriptional regulator, MarR family  ali model follow..  15  5..............THETDQLYQAVQATRPLLRNITAAVERGTLREGVTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEMAKLALFSEGFSSVELTAYHKVQLALTRFFADL. 148
9 -53.5002pfb_A mol:protein length:153 Transcriptional regulator OhrR  ali model follow..  16  1...MDTTTATTARTDTLLQLDNQLCFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAASDERQVIIALTETGRALRSKAGAVPEQVFCAS--ASSLDELRQLKQELEKLRSSLGAG. 153
10 -53.5002pex_A mol:protein length:153 Transcriptional regulator OhrR  ali model follow..  16  1...MDTTTATTARTDTLLQLDNQLSFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAASDERQVIIALTETGRALRSKAGAVPEQVFCAS--ACSLDELRQLKQELEKLRSSLGAG. 153
11 -53.1003deu_A mol:protein length:166 Transcriptional regulator slyA  ali model follow..  17  3.........SSGHIEGRHMLESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL. 152
12 -52.9003fm5_A mol:protein length:150 Transcriptional regulator  ali model follow..  20  3.............MAESQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLDPSDRRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFPTFV.. 147
13 -52.5003cdh_A mol:protein length:155 Transcriptional regulator, MarR family  ali model follow..  17  6............DTPDDTFVSGYLLYLLAASSEEASAQFHDHIRAQGLRVPEWRVLACLVDNDAMMITRLAKLSLMEQSRMTRIVDQMDARGLVTRVADAKDKRRVRVRLTDDGRALAESLVASARAHETRLLSALADTDAARIKGVLRTLLDVLDR.. 150
14 -52.5002fa5_A mol:protein length:162 transcriptional regulator marR/emrR family  ali model follow..  20  3....DLDTPTPSPHPVLLNLEQFLPYRLSVLSNRISGNIAKVYDRYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALSPAGRQVYETVAPLVNEMEQRLMSVFSAEEQQTLERLIDRLAKDGLP.. 156
15 -52.3002fbh_A mol:protein length:146 transcriptional regulator PA3341  ali model follow..  22  7...................DKHYFGTLLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARHDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILANLEN.. 145
16 -52.2003q5f_A mol:protein length:147 Transcriptional regulator slyA  ali model follow..  18  3..................AMESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL. 143
17 -52.2002rdp_A mol:protein length:150 putative transcriptional regulator MarR  ali model follow..  22  1........SNAMPSAMNERTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHDRRVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQEMTK.. 149
18 -52.0003bja_A mol:protein length:139 Transcriptional regulator, MarR family, putat  ali model follow..  19  4....................NRELYGNIRDVYHLLQKNLDKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKKHLN... 139
19 -51.6003jw4_A mol:protein length:148 Transcriptional regulator, MarR/EmrR family  ali model follow..  15  1.........SNAMKESNHLMDTPYSYLIRSIGMKLKTSADARLAELGLNSQQGRMIGYIYENSGIIQKDLAQFFGRRGASITSMLQGLEKKGYIERRIPENNARQKNIYVLPKGAALVEEFNNIFLEVEESITKGLTKDEQKQLMSILIKVNRSM.... 148
20 -51.4001z91_A mol:protein length:147 Organic hydroperoxide resistance transcriptio  ali model follow..  16  3............NKFDHMKLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGLS--KQSGEDLKQLKSALYTLLETLHQK. 146
21 -51.2002a61_A mol:protein length:145 transcriptional regulator Tm0710  ali model follow..  21  2..................SMKQPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKGVMER.. 140
22 -50.6003nrv_A mol:protein length:148 Putative transcriptional regulator (MarR/EmrR  ali model follow..  19  5...............QKINIDRHATAQINMLAKLMLKSSTAYTQKFGIGMTEWRIISVLSSASDCSVQKISDILGLDKAAVSRTVKKLEEKKYIEVNGHSEDKRTYAINLTEMGQELYEVASDFAIEREKQLLEEFEEAEKDQLFILLKKLRNKVDQM. 148
23 -50.6003bro_A mol:protein length:141 Transcriptional regulator  ali model follow..  17  4...................MSRDLGRLLKIASNQMSTRFDIFAKKYDLTGTQMTIIDYLSRNKNVLQRDLESEFSIKSSTATVLLQRMEIKKLLYRKVSGKDSRQKCLKLTKKANKLETIILSYMDSDQSQMTSGLNKEEVVFLEKILKRMIES..... 140
24 -50.2003hrm_A mol:protein length:140 HTH-type transcriptional regulator sarZ  ali model follow..  20  1..............GSHMYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEF--NISEREASDIINNLRNFVSKN.... 139
25 -50.2001s3j_A mol:protein length:155 YusO protein  ali model follow..  12  1.............MKSADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAET.. 144
26 -50.1003eco_A mol:protein length:139 MepR  ali model follow..  20  1...................MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ... 139
27 -49.7002eth_A mol:protein length:154 transcriptional regulator, putative, Mar fami  ali model follow..  19  2.............GSDKIMDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVEALSR.. 145
28 -49.5001jgs_A mol:protein length:138 MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR  ali model follow..  19  2.................FNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQLHQELTKNLTADEVATLEYLLKKVLP...... 138
29 -49.4001lnw_A mol:protein length:147 Multidrug resistance operon repressor  ali model follow..  18  2................NYPVNPDLMPALMAVFQHVRTRIQSELQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQP... 143
30 -49.3003ech_A mol:protein length:142 Multidrug resistance operon repressor  ali model follow..  18  2................NYPVNPDLMPALMAVFQHVRTRIQSELQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQATLVHLLDQCLA...... 140
31 -49.1002nnn_A mol:protein length:140 Probable transcriptional regulator  ali model follow..  17  1...........MSRTTPYRLDDQIGFILRQANQRYAALFANGIGN-GLTPTQWAALVRLGETGPCPQNQLGRLTAMDAATIKGVVERLDKRGLIQRSADPDDGRRLLVSLSPAGRAELEAGLAAAREINRQALAPLSLQEQETLRGLLARLI....... 140
32 -48.5002bv6_A mol:protein length:142 HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA  ali model follow..  19  2...............SHMNLKEQLCFSLYNAQRQVNRYYNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS--SLSQDEVKELNRLLGKVIHAFDE.. 142
33 -48.4003bdd_A mol:protein length:142 Regulatory protein MarR  ali model follow..  15  1................GMQEMEDLLYRLKVADETISNLF---EKQLGISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQREVLVWPTEQAREALITNPSAHHQIKTSMNQILTVEESEQFLATLDKLLIGLQNL. 140
34 -48.3002fbi_A mol:protein length:142 probable transcriptional regulator  ali model follow..  15  1..............GHMSTPRPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKK...... 139
35 -48.0003kp2_A mol:protein length:151 Transcriptional regulator TcaR  ali model follow..  21  7..................DHISFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNMLSI-EALTVGQITEKQGVNKAAVSRRVKKLLNAELVEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSY. 147
36 -48.0003u2r_A mol:protein length:168 Regulatory protein MarR  ali model follow..  17  1....SNAMNERSRPLRFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSPEGMATLQIADRLISRAPDITRLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELARTPHEE.. 155
37 -47.5003g3z_A mol:protein length:145 Transcriptional regulator, MarR family  ali model follow..  21  4......................NQLDQLGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEVMEKTI 140
38 -47.2003tgn_A mol:protein length:146 Adc operon repressor AdcR  ali model follow..  20  7..................DINAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSE-ESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDSKDARVIFYQLTDLARPIAEEEHTLLTY--EQVATQFTPNEQKVIQRFLTALVGEIK... 141
39 -46.9002eb7_A mol:protein length:146 146aa long hypothetical transcriptional regul  ali model follow..  16  1.............MLESNENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGP-KTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEI. 144
40 -46.5002qww_A mol:protein length:154 Transcriptional regulator, MarR family  ali model follow..  15  5.............INTDTENISELLKTYWSIQRISAGYADQNAASLGLTIQQLAMINVIYSTPGISVADLTKRLIITGSSAAANVDGLISLGLVVKKTIPNDSMDLTLKLSKKGEDLSKRSNAFMYKAMMKVFENLTENEIEELIRLNKKVETLLKKS. 153
41 -46.4002fxa_A mol:protein length:207 Protease production regulatory protein hpr  ali model follow..  15  4.....NRVEPPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGS--QPLYHLFGKFPEVAEMMCMI. 154
42 -46.4002fbk_A mol:protein length:181 transcriptional regulator, MarR family  ali model follow..  20  40....................PMLTLLLLERLHAALGREIERTYAASGLNAAGWDLLLTLYRSEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREDERDRRSASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQGV 181
43 -44.9002nyx_A mol:protein length:168 Probable transcriptional regulatory protein,  ali model follow..  19  12..................ESVDVITDALLTASRLLVAISAHSIADENITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRELLAALTKRGRDVVRQVTEHRRTEIARIVEQMAPAERHGLVRALTAFTEAGGE.. 152
44 -41.7002hr3_A mol:protein length:147 Probable transcriptional regulator  ali model follow..  13  6....................DLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREELVRAMHACLDESERALLAAAGPLLTRLAQF.. 144
45 -40.7003nqo_A mol:protein length:189 MarR-family transcriptional regulator  ali model follow..  17  2........MDYSNELKELFLMNQTYATLFTLTNKIQIEGDKYFG--ILTSRQYMTILSILHEEETTLNNIARKMGTSKQNINRLVANLEKNGYVDVIPSPHDKRAINVKVTDLGKKVMVTCSRTGINFMADVFHEFTKDELETLWSLLKKMYRFNGE.. 150
46 -39.8003boq_A mol:protein length:160 Transcriptional regulator, MarR family  ali model follow..  20  24...........................ILRLHGLVFGDLNRQLDETGLSLAKFDAMAQLARNPGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAMSADDRRSFSAKLTDAGLTTFKQASEAHNRILAELLRAVSDQDMVEASAALRGILESMQT.. 155
47 -39.3003f3x_A mol:protein length:144 Transcriptional regulator, marR family, putat  ali model follow..  19  2...............QKIDEKLQLMNTIAKIYRGSIKEFNNRLKLMNLSYLDFSILKATSEEP-RSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSDVENVE--ELLEGLNKILSRIGS.. 141
48 -36.1002frh_A mol:protein length:127 Staphylococcal accessory regulator A  ali model follow..  12  2..............SHMAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIE...................... 126
49 -33.0001tbx_A mol:protein length:99 Hypothetical 11.0 kDa protein  ali model follow..  23  1..........................................MKSTPFFYPEAIVLAYLYDNEGIATYDLYKKVPMSTATFYDAKKFLIQEGFVKERQ---ERGEKRLYLTEKGKLFAISLKTAIETYKQIKKR......................... 93
50 -32.0002d1h_A mol:protein length:109 109aa long hypothetical transcriptional regul  ali model follow..  14  2..............................MKEKLESKKDEIRCCYKITDTDVAVLLKMVEIEKITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTEGKKIGRPKYYYSISSNILEKIRNDLLNCAKRMELAAT...................... 109
51 -30.4001p4x_A mol:protein length:250 staphylococcal accessory regulator A homologu  ali model follow..  12  3..................YNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQI............................... 114
52 -29.6001ku9_A mol:protein length:152 hypothetical protein MJ223  ali model follow..  14  4...........................MEEAKKLIIELFSELAKIHGLNKSVGAVYAILYSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKNYYEAVDGDIAKRKHDLIAKTYEDLKKLEEKCNEEEKEFIKQKIKGIERMKKIS. 140
53 -29.3002wte_A mol:protein length:244 CSA3  ali model follow..  17  138.........................................RALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQ-----KGKDRKVELNELGLNVIKLNKSVIEKSSEELVKENKGKEVNIP............... 237
54 -28.1002qvo_A mol:protein length:95 Uncharacterized protein AF_1382  ali model follow..  14  1......................................MEDERIKLLFKEKALEILMTIYGGNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECEL---EGRTKIIRLTDKGQKIAQQIKSIIDIMENDT........................... 95
55 -26.2003cta_A mol:protein length:230 Riboflavin kinase  ali model follow..  16  3.......................................LETDDQYYRAIKKIKEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTV---TKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVA...... 113
56 -24.0003r0a_A mol:protein length:123 Putative transcriptional regulator  ali model follow..  16  3..........................AMIDFACKEFKVEDVIKCALNLTKADLNVMKSFLNEPDIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQQNLDGGGYVYIYKIYSNQIRNIIQKIVQSWADRLGQELKEWENG................. 121
57 -21.6002dk5_A mol:protein length:91 DNA-directed RNA polymerase III 39 kDa polype  ali model follow..  10.......................................QNAGKMKGSDNQEKLVYQIIEDNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYN............................................... 84
58 -19.5001ub9_A mol:protein length:100 Hypothetical protein PH1061  ali model follow..  16  18...................................................RLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGL........................... 98
59 -17.7001sfx_A mol:protein length:109 Conserved hypothetical protein AF2008  ali model follow..  17  9......................................LVKALEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIER............................. 100
60 -16.1002obp_A mol:protein length:96 Putative DNA-binding protein  ali model follow..  12  27......................................................EAGIENGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGR--GHASLTQEGAALAAQL...................................... 91
61 -15.7002h09_A mol:protein length:155 Transcriptional regulator mntR  ali model follow..  20  44......................................................LISDLIREVGARQVDMAARLGVSQPTVAKMLKRLATMGLIEMIPWRG------VFLTAEGEKLAQESRERHQIVENFLLVGVSPEIARRDAEGMEHHVSE..... 139
62 -15.6001fx7_A mol:protein length:230 IRON-DEPENDENT REPRESSOR IDER  ali model follow..  13  3..............................................ELVDTTEMYLRTIYEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH------LELTEKGRALAIAVMRKHRLAERLLVDVIGHAEACRWEHVMEDVERRLVKVL 120
63 -15.5003R60 Entity 1(prereleased)  ali follow..  17  11......................................................QIYMLIEEKGARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRG------LVLTSKGKKIGKRLVYRHELLEQFLRIGVDEEKIYNDVEGIEHHLSW..... 106
64 -15.5001on1_A mol:protein length:142 Transcriptional regulator mntR  ali model follow..  14  2...............................................TTPSMEDYIEQIYEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRG------LVLTSKGKKIGKRLVYRHELLEQFLRIGVDEEKIYNDVEGIEHHLSW..... 107
65 -15.3002isy_A mol:protein length:157 Iron-dependent repressor ideR  ali model follow..  13  3..............................................ELVDTTEMYLRTIYEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH------LELTEKGRALAIAVMRKHRLAERLLVDVIGHAEACRWEHVMEDVERRLVKVL 120
66 -15.3001bi0_A mol:protein length:226 DIPHTHERIA TOXIN REPRESSOR  ali model follow..  10  3..............................................DLVDTTEMYLRTIYEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS------LQMTPTGRTLATAVMRKHRLAERLLTDIIGHDEACRWEHVMDEVERRLVKVL 120
67 -15.1002x4h_A mol:protein length:139 HYPOTHETICAL PROTEIN SSO2273  ali model follow..  14  2......................................MRVDSQMSNLSRREFSYLLTIKSGEGAKINRIAKDLKIAPSSVFEEVSHLEEKGLVKKKED--------VWITNNGTRSINYLIKAHRVIEILLVNGIDKQTACEYSKQFDYLIPE..... 115
68 -14.9003hrs_A mol:protein length:214 Metalloregulator ScaR  ali model follow..  14  1................................................TPNKEDYLKCLYRHNKITNKEIAQLMQVSPPAVTEMMKKLLAEELLIKDKKAG------YLLTDLGLKLVSDLYRKHRLIEVFLVHHLGHEEAEVLEHTVDHFVERLDQLL 116
69 -14.6001xcv_A mol:protein length:139 Diphtheria toxin repressor mutant  ali model follow..  11  3..............................................DLVDTTEMYLRTIYEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS------LQMTPTGRTLATAVMRKARLAERLLTDIIGHDEADRWEHVMDEVERRLVKVL 120
70 -14.5002p8t_A mol:protein length:200 Hypothetical protein PH0730  ali model follow..  16  14................................................EYTVEDVLAVIFLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKQR--------HFLTLKGKEIRDKLLSMFSEPIGVSVDGYP...................... 96
71 -14.3001sfu_A mol:protein length:75 34L protein  ali model follow..  25  5.......................................SCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPS............................................................ 64
72 -13.9002f2e_A mol:protein length:146 PA1607  ali model follow..  20  16...........................................RPLDVIGDGWSMLIVRDAFEGLTRGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAESGSH-QEYRLTDKGRALFPLLVAIRQ................................. 98
73 -13.8002cg4_A mol:protein length:152 REGULATORY PROTEIN ASNC  ali model follow..  11  1..........................................MENYLIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVL 123
74 -13.8003b73_A mol:protein length:111 PhiH1 repressor-like protein  ali model follow..  19  11...............................................MTIWDDRILEIIHEEGNGSPKELEDRIRISKSSVSRRLKKLADHDLLQPLAN-------VYVITEEGEAYLN........................................ 78
75 -13.8001xn7_A mol:protein length:78 Hypothetical protein yhgG  ali model follow..  18  7......................................................VRDLLALRGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPD......................................................... 54

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 3 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;