current user: public




Query: 3s2w_A mol:protein length:159 Transcriptional regulator, MarR family, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst SNAMNTTEFDGISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDEKDRRSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIMLast
1 -71.5003s2w_A mol:protein length:159 Transcriptional regulator, MarR family  ali model  100  1SNAMNTTEFDGISHAEGLCDKEFIGKAISYLYRYGQIYIGKKIEPYGIGSGQFPFLMRLYREDGINQESLSDYLKIDKGTTARAIQKLVDEGYVFRQRDEKDRRSYRVFLTEKGKKLEPDMKKIASEWGEILFSSFDDRQRREITNSLEIMFENGLKIM 159
2 -63.4003bpx_A mol:protein length:148 Transcriptional regulator  ali model follow..  25  2...............SHMDRDIPLKGLLSIILRSHRVFIGRELGHLNLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYILEVTRRGEEIIPLILKVEERWEDLLFRDFTEDERKLFRKMCRRLAEEAVRM. 144
3 -63.0004mnu_A mol:protein length:153 SlyA-like transcription regulator  ali model follow..  25  2..................NAMKDILRDIGVIARALDSISNIEFKELNLAKGQFIYLVRICENQGIIQEKLVDILKIDRTTASRAIKNLEKNGLIIKKQNKNNKKNKLLFPTEKGQQLYPLIIRENEYSNAVALKGFTEAEINMLTDALKKVKENIAD.. 140
4 -62.8001lj9_A mol:protein length:144 transcriptional regulator SlyA  ali model follow..  24  1.....................TDILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVALQGLSEVEISQLADYLVRMRKNVSE.. 136
5 -55.6003oop_A mol:protein length:143 Lin2960 protein  ali model follow..  18  1.............SNAMRGYYDEISFDVNTTAKKMHLFLMRSIASYDVTPEQWSVLEGIEANEPISQKEIALWTKKDTPTVNRIVDVLLRKELIVREISTEDRRISLLSLTDKGRKETTELRDIVEASCEKMFAGVTRTDLEQFTAILKNISTNIE... 143
6 -55.3003cjn_A mol:protein length:162 Transcriptional regulator, MarR family  ali model follow..  18  3AMAESTDQTEQLRELAEIGLEGYAPYLMNRIMGRYNANLRKEMTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDSDDQRSSRVYLTPAGRAVYDRLWPHMRASHDRMFQGITPQERQAFLATLNKMLANIRVH. 160
7 -53.8005F6F Entity 1(prereleased)  ali follow..  19  1...MSSGVDLGTENLYFQSNEFTYSYLFRMISHEMKQKADQKLEQFDITNEQRHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ... 155
8 -52.2003deu_A mol:protein length:166 Transcriptional regulator slyA  ali model follow..  18  14....................ESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL. 152
9 -52.2003bj6_A mol:protein length:152 Transcriptional regulator, MarR family  ali model follow..  16  13......................QAVQATRPLLRNITAAVERGTLREGVTVGQRAILEGLSLTPGATAPQLGAALQMKRQYISRILQEVQRAGLIERRTNPEHARSHRYWLTPRGEAIITAIRADEMAKLALFSEGFSSVELTAYHKVQLALTRFFAD.. 147
10 -51.6003e6m_A mol:protein length:161 MarR family Transcriptional regulator  ali model follow..  15  4MTEARKIPKPSFPYGSPGELNSFLPYLLTRITHIWSSELNQALASEKLPTPKLRLLSSLSAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQRKRTVVLTRKGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILKGKTDY. 161
11 -51.6002fbh_A mol:protein length:146 transcriptional regulator PA3341  ali model follow..  21  3...............MAQTDKHYFGTLLAQTSRAWRAELDRRLSHLGLSQARWLVLLHLARRDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVLTGIDESEQALCQQVLLRILANLEN.. 145
12 -51.4003jw4_A mol:protein length:148 Transcriptional regulator, MarR/EmrR family  ali model follow..  15  1.........SNAMKESNHLMDTPYSYLIRSIGMKLKTSADARLAELGLNSQQGRMIGYIYENSGIIQKDLAQFFGRRGASITSMLQGLEKKGYIERRIPENNARQKNIYVLPKGAALVEEFNNIFLEVEESITKGLTKDEQKQLMSILIKVNRSM.... 148
13 -51.3005FB2 Entity 1(prereleased)  ali follow..  20  1..................SNEFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ... 140
14 -51.2004l9j_A mol:protein length:140 MepR  ali model follow..  20  1..................SNEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ... 140
15 -51.1003k0l_A mol:protein length:162 Repressor protein  ali model follow..  16  1....SNAMLRSSSVDRKREEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST.. 153
16 -51.0003q5f_A mol:protein length:147 Transcriptional regulator slyA  ali model follow..  18  5....................ESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL. 143
17 -50.7004l9t_A mol:protein length:145 MepR  ali model follow..  20  2....................EFTYSYLFRMISHEMKQKADQKLEQLDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ... 139
18 -50.6004l9n_A mol:protein length:145 MepR  ali model follow..  20  2....................EFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEVFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ... 139
19 -50.5004aih_A mol:protein length:151 TRANSCRIPTIONAL REGULATOR SLYA  ali model follow..  16  2....................ESTLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQL. 140
20 -50.5004ld5_A mol:protein length:145 MepR  ali model follow..  20  2....................EFTYSYLFRMISHEMKPKADQKLEQFDITNEQGHTLGYLYQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ... 139
21 -49.5003fm5_A mol:protein length:150 Transcriptional regulator  ali model follow..  20  10....................SDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLDPSDRRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFPTFV.. 147
22 -48.4003kp2_A mol:protein length:151 Transcriptional regulator TcaR  ali model follow..  21  10.....................SFLEKFINDVNTLTAKLLKDLQTEYGISAEQSHVLNML-SIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVEKPDSNTDQRLKIIKLSNKGKKYIKERKAIMSHIASDMTSDFDSKEIEKVRQVLEIIDYRIQSY. 147
23 -47.7003bro_A mol:protein length:141 Transcriptional regulator  ali model follow..  17  5....................SRDLGRLLKIASNQMSTRFDIFAKKYDLTGTQMTIIDYLSRNKNVLQRDLESEFSIKSSTATVLLQRMEIKKLLYRKVSGKDSRQKCLKLTKKANKLETIILSYMDSDQSQMTSGLNKEEVVFLEKILKRMIES..... 140
24 -47.7003cdh_A mol:protein length:155 Transcriptional regulator, MarR family  ali model follow..  18  14....................SGYLLYLLAASSEEASAQFHDHIRAQGLRVPEWRVLACLVDNDAMMITRLAKLSLMEQSRMTRIVDQMDARGLVTRVADAKDKRRVRVRLTDDGRALAESLVASARAHETRLLSALADTDAARIKGVLRTLLDVLDR.. 150
25 -47.1003bja_A mol:protein length:139 Transcriptional regulator, MarR family, putat  ali model follow..  19  3...................NNRELYGNIRDVYHLLQKNLDKAIEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLTKKGEETKKQVDVQYSDFLKENCGCFTKEEEGILEDLLLKWKKHLN... 139
26 -47.0001lnw_A mol:protein length:147 Multidrug resistance operon repressor  ali model follow..  18  1...............MNYPVNPDLMPALMAVFQHVRTRIQSELQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQ.... 142
27 -46.8003ech_A mol:protein length:142 Multidrug resistance operon repressor  ali model follow..  18  1...............MNYPVNPDLMPALMAVFQHVRTRIQSELQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHLHAELIMSRVHDELFAPLTPVEQATLVHLLDQCLA...... 140
28 -46.2003vb2_A mol:protein length:144 Multiple antibiotic resistance protein marR  ali model follow..  19  13......................PLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLSSIRSAASITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAISEQSHQLGQDLHQELTKNLTADEVATLEYLLKKVLP...... 144
29 -45.8003vod_A mol:protein length:144 Multiple antibiotic resistance protein marR  ali model follow..  19  13......................PLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLGQDLHQELTKNLTADEVATLEYLLKKVLP...... 144
30 -45.7003nrv_A mol:protein length:148 Putative transcriptional regulator (MarR/EmrR  ali model follow..  19  6................KINIDRHATAQINMLANKLMLKSSTAYQKFGIGMTEWRIISVLSSASDCSVQKISDILGLDKAAVSRTVKKLEEKKYIEVNGHSEDKRTYAINLTEMGQELYEVASDFAIEREKQLLEEFEEAEKDQLFILLKKLRNKVDQM. 148
31 -44.8003bdd_A mol:protein length:142 Regulatory protein MarR  ali model follow..  16  7.........................DLLYRLKVADETISNLFEKQLGISLTRYSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNPDNQREVLVWPTEQARELITNPSAHHQAIKTSMNQILTVEESEQFLATLDKLLIGLQNL. 140
32 -44.2003tgn_A mol:protein length:146 Adc operon repressor AdcR  ali model follow..  19  1............MRQLAKDINAFLNEVILQAENQHEILIGHCTSEVALTNTQEHILMLLSE-ESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDSKDARVIFYQLTDLARPIAEEEHTLLTY--EQVATQFTPNEQKVIQRFLTALVGEIK... 141
33 -44.1002a61_A mol:protein length:145 transcriptional regulator Tm0710  ali model follow..  21  6......................PFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKGVMER.. 140
34 -43.8003g3z_A mol:protein length:145 Transcriptional regulator, MarR family  ali model follow..  21  9...........................LGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEVMEKTI 140
35 -43.7002rdp_A mol:protein length:150 putative transcriptional regulator MarR  ali model follow..  22  2.........NAMPSAMNERTVAELEKLLRYIAANLKQRGREILTNYPITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDEHDRRVVRIRLLEKGERIIEEVIEKRQRDLANVLESFSDEEIVVFERCLRKLHQEMTK.. 149
36 -43.4002nnn_A mol:protein length:140 Probable transcriptional regulator  ali model follow..  17  1...........MSRTTPYRLDDQIGFILRQANQRYAALFANGIGN-GLTPTQWAALVRLGETGPCPQNQLGRLTAMDAATIKGVVERLDKRGLIQRSADPDDGRRLLVSLSPAGRAELEAGLAAAREINRQALAPLSLQEQETLRGLLARLI....... 140
37 -43.1002fa5_A mol:protein length:162 transcriptional regulator marR/emrR family  ali model follow..  21  16.................LNLEQFLPYRLSVLSNRISGNIAKVYGDYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALSPAGRQVYETVAPLVNEMEQRLMSVFSAEEQQTLERLIDRLAKDGLPR. 157
38 -42.7004fht_A mol:protein length:157 PcaV transcriptional regulator  ali model follow..  15  10....................ATHPGHLARRLQQAHYLLWNTMVSE-ETTSPQYAVLNALVAEPGLDQRTVGERVGLDRSTIAEVVSRLGRRGLLDKVRDPQDGRRSLLRLTDEGLRVHRRLGVRIARMNQVFLAPLAADEQAVFFDLIRRVADA..... 142
39 -42.4004em0_B mol:protein length:178 Uncharacterized HTH-type transcriptional regu  ali model follow..  16  19....DDDDKAMADIGSDFMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVANISQDQMQETINVMNQIHEILLK.. 173
40 -40.8002eb7_A mol:protein length:146 146aa long hypothetical transcriptional regul  ali model follow..  17  10......................QIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGP-KTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEI. 144
41 -40.6002eth_A mol:protein length:154 transcriptional regulator, putative, Mar fami  ali model follow..  19  1............MGSDKIMDALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVEALSR.. 145
42 -40.4002qww_A mol:protein length:154 Transcriptional regulator, MarR family  ali model follow..  15  3...........VGINTDTENISELLKTYWSIQRISAGYADQNAASLGLTIQQLAMINVIYSTPGISVADLTKRLIITGSSAAANVDGLISLGLVVKKTIPNDSMDLTLKLSKKGEDLSKRSTAFMYKAMMKVFENLTENEIEELIRLNKKVETLLKK.. 152
43 -40.2001s3j_A mol:protein length:155 YusO protein  ali model follow..  13  10......................DIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYLSFLTEEEMLQAAHITAKLAQAAET.. 144
44 -40.2004xrf_A mol:protein length:142 Transcriptional regulator, MarR family  ali model follow..  19  1.................MTHIDKIQALAFSIGKKMQTELLEQMQATGLTPPQFYILKILDHYGASRATTLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRRVVIIELTKKGKARVEEAMTARNEHIAKYFSHLELQEREDLLRLFEKLETIICG.. 140
45 -39.6002fbi_A mol:protein length:142 probable transcriptional regulator  ali model follow..  15  7....................RPSLTLTLLQAREAAMSFFRPSLNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQERFGEEKLAQLLELLNELKK...... 139
46 -38.8005aip_A mol:protein length:146 TRANSCRIPTIONAL REGULATOR, MARR FAMILY  ali model follow..  13  7....................HASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDAL. 144
47 -38.3003u2r_A mol:protein length:168 Regulatory protein MarR  ali model follow..  20  24...........................LWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSVEGMATLQIADRLISRAPDITRLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELARTPHEE.. 155
48 -37.8002nyx_A mol:protein length:168 Probable transcriptional regulatory protein,  ali model follow..  19  15.....................DVITDALLTASRLLVAISAHSIAQVNITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGAELIDRLPHPTSRRELLAALTKRGRDVVRQVTEHRRTEIARIVEQMAPAERHGLVRALTAFTEAGGE.. 152
49 -36.8003nqo_A mol:protein length:189 MarR-family transcriptional regulator  ali model follow..  17  3.........DYSNELKELFLMNQTYATLFTLTNKIQIEGDKYFG--ILTSRQYMTILSILHEEETTLNNIARKMGTSKQNINRLVANLEKNGYVDVIPSPHDKRAINVKVTDLGKKVMVTCSRTGINFMADVFHEFTKDELETLWSLLKKMYRFNGE.. 150
50 -35.8004hbl_A mol:protein length:149 Transcriptional regulator, MarR family  ali model follow..  19  1.........SNAMKQEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVMLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAIS---SCLPQEFDTTEYDETKYVFEELEQTLKHLI 147
51 -35.6002pex_A mol:protein length:153 Transcriptional regulator OhrR  ali model follow..  17  1...MDTTTATTARTDTLLQLDNQLSFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAASDERQVIIALTETGRALRSKAGAVPEQVFCAS--ACSLDELRQLKQELEKLRSSLGA.. 152
52 -35.5002pfb_A mol:protein length:153 Transcriptional regulator OhrR  ali model follow..  17  1...MDTTTATTARTDTLLQLDNQLCFALYSANLAMHKLYRGLLKALDLTYPQYLVMLVLWETDERSVSEIGERLYLDSATLTPLLKRLQAAGLVTRTRAASDERQVIIALTETGRALRSKAGAVPEQVFCAS--ASSLDELRQLKQELEKLRSSLGA.. 152
53 -35.5004b8x_A mol:protein length:147 POSSIBLE MARR-TRANSCRIPTIONAL REGULATOR  ali model follow..  15  13...........................IMRAQQILLGEVDAVVKPYGLTFARYEALVLLTFSKSLPMSKIGERLMVHPTSVTNTVDRLVRSGLVAKRPNPNDGRGTLATITDKGREVVEAATRDLMA-MDFGLGAYDAEECGEIFAMLRPLRVAAGDF. 144
54 -34.8003boq_A mol:protein length:160 Transcriptional regulator, MarR family  ali model follow..  19  15..................QNQTRLWLNILRLHGLVFGDLNRQLLETGLSLAKFDAMAQLARNPGLSMGKLSGALKVTNGNVSGLVNRLIKDGMVVKAMSADDRRSFSAKLTDAGLTTFKQASEAHNRILAELLRAVSDQDMVEASAALRGILESMQT.. 155
55 -34.2003hrm_A mol:protein length:140 HTH-type transcriptional regulator sarZ  ali model follow..  20  4.................MYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEF--NISEREASDIINNLRNFVSKN.... 139
56 -34.0001z91_A mol:protein length:147 Organic hydroperoxide resistance transcriptio  ali model follow..  16  3............NKFDHMKLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGLS--KQSGEDLKQLKSALYTLLETLHQ.. 145
57 -33.9002fxa_A mol:protein length:207 Protease production regulatory protein hpr  ali model follow..  14  4.....NRVEPPYDVKEALVFTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLTEEGTEVFWSLLEEFDPTRNAVFKGS--QPLYHLFGKFPEVAEMMC... 152
58 -33.5004fx0_A mol:protein length:148 PROBABLE TRANSCRIPTIONAL REPRESSOR PROTEIN  ali model follow..  15  1.................MAFDECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSEGLTMSELAARIGVERTTLTRNLEVMRRDGLV-RVMAGADARCKRIELTAKGRAALQKAVPLWRGVQAEVTASVG--DWPRVRRDIANLGQAAEAC. 143
59 -33.5002fbk_A mol:protein length:181 transcriptional regulator, MarR family  ali model follow..  21  47...........................LERLHAALGREIERTYAASGLNAAGWDLLLTLYRSAGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREDERDRRSASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQGV 181
60 -33.3002bv6_A mol:protein length:142 HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA  ali model follow..  20  4.................MNLKEQLCFSLYNAQRQVNRYYSNKFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASAS--SLSQDEVKELNRLLGKVIHAFDE.. 142
61 -33.0003f3x_A mol:protein length:144 Transcriptional regulator, marR family, putat  ali model follow..  19  2...............QKIDEKLQLMNTIAKIYRGSIKEFNNRLKLMNLSYLDFSILKATSEEP-RSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSDVENVE--ELLEGLNKILSRIGS.. 141
62 -30.8004yif_A mol:protein length:164 Uncharacterized HTH-type transcriptional regu  ali model follow..  16  22......................RLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMTPGALAIRERVRPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAELVKAARRARQEWLAERLATLNRSERDILRSLMLALVDE..... 156
63 -30.7004rbr_A mol:protein length:139 HTH-type transcriptional regulator rot  ali model follow..  11  15...........................LETLLGDINSIFSEIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPVDDERTVIIHFNEKLQQEKVELLNFISD-----AIASRATAMQNSLNAIIAV........ 133
64 -30.7004q77_A mol:protein length:139 HTH-type transcriptional regulator rot  ali model follow..  11  15...........................LETLLGDINSIFSEIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPVDDERTVIIHFNEKLQQEKVELLNFISD-----AIASRATAMQNSLNAIIAV........ 133
65 -30.2003zmd_A mol:protein length:178 PUTATIVE TRANSCRIPTIONAL REGULATOR  ali model follow..  16  26..................DTEQCAWRTHLEVNRLLTHQLEKDLQPFGLTMNDYEILVNLSESEGMRMSDLATATMQSKSRLSHQITRMENANLVRRENCESDRRGLFAVLTEHGLETMRKVAP-VASVRRHFIDLLAPEDLTELDKALKPIAEHLRG.. 167
66 -29.8001tbx_A mol:protein length:99 Hypothetical 11.0 kDa protein  ali model follow..  23  1..........................................MKSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNAETATFYDAKKFLIQEGFVKER---QERGEKRLYLTEKGKLFAISLKTAIETYKQIKKR......................... 93
67 -27.8002hr3_A mol:protein length:147 Probable transcriptional regulator  ali model follow..  15  1...............MPTNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWVRAMHACLDESERALLAALLTRLAQ...... 143
68 -27.5003zpl_A mol:protein length:177 PUTATIVE MARR-FAMILY TRANSCRIPTIONAL REPRESSO  ali model follow..  15  18..................AEEQLVWRSYIEAATLLEDHLDRQLQDAGMPHVYYGLLVKLAESPRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDKRGQFAILTDEGYEVLRRTAP-VDAVRQAVFDRLTPEQQKSLGEIMRIVAEGLQ... 159
69 -27.2002frh_A mol:protein length:127 Staphylococcal accessory regulator A  ali model follow..  14  15...........................LLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNK................................ 116
70 -25.1002wte_A mol:protein length:244 CSA3  ali model follow..  15  138.........................................RALMRDYSREEMKLLNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQ-----KGKDRKVELNELGLNVIKLNKSVIESS-KSSEELVKENKGKEVNIPY........... 238
71 -23.8001p4x_A mol:protein length:250 staphylococcal accessory regulator A homologu  ali model follow..  14  139..............................LMMYTMYFKNIIKKHLTLSFVEFTILAIIQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLLAQVNQ................................ 237
72 -22.2002obp_A mol:protein length:96 Putative DNA-binding protein  ali model follow..  15  6.......................................GNEQNGDGIDPAIVEVLLVLREAGIWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGH--ASLTQEGAALAAQLFP.................................... 93
73 -21.7003cta_A mol:protein length:230 Riboflavin kinase  ali model follow..  15  2............................................SLETDDQYYRAIKKIKNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTV---TKRGQILNITEKGLDVLYTEFADLSRILAIKNNVVITGTVTSGMGEGRYYVA...... 113
74 -20.5003r0a_A mol:protein length:123 Putative transcriptional regulator  ali model follow..  17  22.............................................LNLTKADLNVMKSFLNEPDIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQQNLDGGYVYIYKIYSKNQIRNIIQKIVQSWADRLGQELKEWENG................. 121
75 -19.9004asn_A mol:protein length:101 TUBR  ali model follow..  16  6.........................................EEVMRKLTIEDVSILGWLFQNEAIKKSSIADELEYSTANFRKTLNKLEAIHFIGTVTGGKEHK---LYLTEYGQQAVQQAIHHGEENEEV............................ 98

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.