current user: public




3qkuA
Query: 3qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKKTINNRIKEYGGSGGIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVSLast
1 -117.0003qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase  ali model  100  1MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKKTINNRIKEYGGSGGIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 359
2 -106.0003qkt_A mol:protein length:339 DNA double-strand break repair rad50 ATPase  ali model follow..  98  1MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKGGSGG--------------------TEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 339
3 -75.1003aux_A mol:protein length:371 DNA double-strand break repair rad50 ATPase  ali model follow..  29  3MILKEIRMNNFKSHVNSRIKFEKGIVAIIGENGSGKSSIFEAVFFALFGAGS--NFNYDTIITKGKKSVYVELDFEVNGNNYKIIREYDSGRGGAKLYKNGKPYATTISAVNKAVNEILG------VDRNMFLNSIYIKQGEIAKFLSLKSEKLETVAKLLGIDEFEKCYQKMGEIVKEYEKRLERIEGEKEMSNLEKEKEKLTKFVEYLDKVRRIFQAYLREKYVPLIQKYLNEAFSEFDLPYSFVELTKDFEVRVHAPNGVLTIDNLSGGEQIAVALSLRLAIANALINRVECIILDEPTVYLDENRRAKLAEIFRKV-KSIPQMIIITHHRELEDVADVIINVKKDGNVSKVKI.. 369
4 -64.0003tho_A mol:protein length:382 Probable DNA double-strand break repair Rad50  ali model follow..  20  12MRPERLTVRNFLGLKNVDIEFQSGITVVEGPNGAGKSSLFEAISFALFGNGI-RYPNSYDYVNRNAVDARLVFQFERGGKRYEIIREINALQRKHNAKLSEILENGKKAAIAAKPTSVKQEVEKILIEHRTFIRTVFLPQGEIDKLLISPSEITEIISDVFQSKLLKEKMKKLENEISSGGAGGAGGSLEKKLKEMSDEYNNLDLLRKYLFDKSNFSRYFTGRVLEAVLKRTKAYLDILTNGRFDIDFDDEKGGFIIKDWGIERPARGLSGGERALISISLAMSLAEVASGRLDAFFIDEGFSSLCTENKEKIASVLKELERLNKVIVFITCDREFSEAFDRKLRITGGVVVNE..... 376
5 -58.0003qkr_A mol:protein length:203 DNA double-strand break repair rad50 ATPase  ali model follow..  97  1MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILESDEAREKVVREVLNLDKFETAYKKLSELKKTINNRIKEYRDILA....................................................................................................................................................................... 192
6 -48.9001w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1  ali model follow..  17  2GRLVGLELSNFKSYRGVTK-GESNFTSIIGPNGSGKSNMMDAISFVL-RSNHLRSNILKDLIYRGVLNAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSQIAAQSPVELSRMFEEVSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKSPGLEVLFQGPRGSRYDEAEGRNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEKRFKDMEYLSGGEKTVAALALLFAINSY--QPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIIT 422
7 -48.4003qkr_B mol:protein length:179 DNA double-strand break repair rad50 ATPase  ali model follow..  93  2.....................................................................................................................................................................................EKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 179
8 -45.9002o5v_A mol:protein length:359 DNA replication and repair protein recF  ali model follow..  14  4VRLSALSTLNYRNLAPGTLNFPEGVTGIYGENGAGKTNLLEAAYLALTG--QTDAPRIEQLIQAGETEAYVRADLQQGGSLSIQEVGLGRGRRQLKVDGVRARTG-PRGGAVWIRPEDSELVFGPPSGRRAYLDSLLSRLSAGEQLSRYERTVSQRNAALRGGEEMHVWDDVLLKLGTEIMLFRRRALTRLDELAREANAQLGSRKTLALTLTESTSPETYAADLRG---------RRAEELARGSTVTGPHRDDLLLTLGDFPASDYASRGEGRTVALALRRAELELLFGEDPVLLLDDFTAELDPHRRQYLLDLAASVPQAIVTGTELAPGAALTLRAQAGRFTPVADEEMQAE... 356
9 -45.4001e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN  ali model follow..  20  1MRLKKLYLKGFKSFGRSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFQSKKELRASEKFDMIFAGSENAYVELVFEENGEEITVARELKRTGEN--------------TYYLNGSPVRLKDIRDRFAGTGLGVDFYSIVGQGQIDRIVNASPEELRLESS-KHPTSLVPRGSYQRVNESFNRFISLLGGEGRLNIVSEAKSILDAGFEISIRKPGR---------------------------------------------RDQKLSLLSGGEKALVGLALLFALMEI--KPSPFYVLDEVDSPLDDYNAERFKRLLKENSKH-TQFIVITHNKIVMEAADLLHGVTMVNGVSAIVPVE 307
10 -43.2003euj_A mol:protein length:483 Chromosome partition protein mukB, Linker  ali model follow..  10  8.KFRSLTLINWNGFFARTFDFDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLNFRNTDYHSFMFDLGILPKRLRSSSDRNKFYKLIEASLYGGISSVITKSLRDYLLPENSGVRQAFQDMEAALRENSGGSGGSISAESVANILRKTIQREQNRILQLNQLQNIAFGQVKGVRLVVNIRDTHSILLNALSDQHEQHKDLFESQKLSFSEALAMLYKRINPHIELGQRMPQTIGEELLDYRNYLDLEVETLRGAYGWMRAESSALSTGEAIGTGMSILLMVVQSWEEEILPCRLLFLDQA-ARLDAMSINTLFELCERL--DMQLLIAAPENISPERGTTYKLVRKILANQEYVHVVG 478
11 -32.1001qhl_A mol:protein length:227 PROTEIN (CELL DIVISION PROTEIN MUKB)  ali model follow..  12  5GKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPE........................................................................................................................................... 224
12 -23.0003kta_B mol:protein length:173 Chromosome segregation protein smc  ali model follow..  25  60.......................................................................................................................................................................................................................................................................KRIEAMSGGEKALTALAFVFAIQKF--KPAPFYLFDEIDAHLDDANVKRVADLIKESSKE-SQFIVITLRDVMMANADKIIGVSMRDGVSKVVSLS 152
13 -21.9001xew_X mol:protein length:182 SMC protein  ali model follow..  19  2PYIEKLELKGFKSYGNVVIPFSKGFTAIVGANGSGKSNIGDAILFVLLSAKAMRASRISDLIFAGSKNAEVAIYFNNEDDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYN-------------IVLQGDITKFIKMSLERRLLIDDISGIAEYDSKKEKALE........................................................................................................................................................................................ 181
14 -20.9002ihy_A mol:protein length:279 ABC transporter, ATP-binding protein  ali model follow..  18  16IQLDQIGRMGKTILKKISWQIAKG--ILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKMPGKVGYSAETVRQHIGFVSHSLL------------------------------------EKFQEGERVIDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVGMSAKA-----------------------------------------------------------------------------------------------QQYIGYLSTGEKQRVMIA------RALMGQPQVLILDEPAAGLDFIARESLLSILDSLSDSYPAMIYVTHFEEITANFSKILLLK............ 231
15 -18.7001sgw_A mol:protein length:214 putative ABC transporter  ali model follow..  20  5LEIRDLSVGDKPVLERITMTIEKGVVNFHGPNGIGKTTLLKTISTYL-------KPLKGEIIYNGVPITKVKGKIFFLPEEIIVPRKI---------------------------------------------------------------SVEDYLKAVASLYGVKVNKNEIMDALESVE-----------------------------------------------------------------------------VLDLKKKLGELSQGTIRRVQLA------STLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSR--EELSYCDVNENLHK........... 199
16 -18.5002pcj_A mol:protein length:224 Lipoprotein-releasing system ATP-binding prot  ali model follow..  22  5.....LRAENIKKLKGISLSVKKGFVSIIGASGSGKSTLLYIL-------------------------------------------------------------------------------LDAPTEGKVFLEGKEVDYTNEKELSLLRNRKLGFVFQFHYL----------------------------------------------------------IPELTALENVIVPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELSGGEQQ------RVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAELTHRTLEMK............ 213
17 -18.3001l7v_C mol:protein length:249 Vitamin B12 transport ATP-binding protein btu  ali model follow..  20  5.....MQLQDVAELGPLSGEVRAGILHLVGPNGAGKSTLLARMAGMTSGK-----------------------------------------------------------------------------------GSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLG--------------------------------------------------------------RSTNQLSGGEWQRVRLAAVVLQTPQANPAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTRHAHRAWLLK............ 207
18 -18.2002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model follow..  21  5LSVENLGF-YYQAFQQLNFDLNKGILAVLGQNGCGKSTLLDLLLGIH----------------------------RPIQGKIEVYQSIG-----------------------------VPQFFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAK--------------------------------------------------------------------------------------------REFTSLSGGQRQLILIARAIA------SECKLILLDEPTSALDLANQDIVLSLLIDLQSQNMTVVFTTHQNQVVAIANKTLLLN............ 203
19 -18.0002pjz_A mol:protein length:263 Hypothetical protein ST1066  ali model follow..  21  2IQLKNVGITERFSLENINLEVNGEKVIILGPNGSGKTTLLRAISGLL------------------PYSGNIFIN------------------------------------------MEVRKIRNYIRYSTNLPEAYEIGVTVNDIVYLYEELKGLDRDLFLEMLKALKLGEEILR----------------------------------------------------------------------------------------RKLYKLSAGQSVLVRTSLALAS------QPEIVGLDEPFENVDAARRHVISRYIKEYGK---EGILVTHELDMLNLYKEYKAYFLVGN........ 202
20 -17.4002zu0_C mol:protein length:267 Probable ATP-dependent transporter sufC  ali model follow..  19  16LSIKDLSVEDKAILRGLSLDVHPGVHAIMGPNGSGKSTLSATL---------------------------------AGREDYEVTG-----------------------------------------------GTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGV--SNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVG---------------------------------------------FSGGEKKRNDILQMAVL------EPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQG........ 236
21 -16.5002vf7_A mol:protein length:842 EXCINUCLEASE ABC, SUBUNIT A.  ali model follow..  16  501...GWLELNGVTNLDNLDVRFPLGMTSVTGVSGSGKSTLV------------------QALVDALAAHFGQPVNPDPEDDEDPADHTAGSARLGGDLAQITRLVRVDQKPIGRTPRSNMATYTGLFDQVRKFAATPLAKKRGYNAGRFSFNVKGGRCEHCQGEGWVMVELLFLPSVYAPCPVCHGTRYNAETLEVEYRGKNIADVLALTVDEAHDFFADE----------------------SAIFRALDTLREVGLGYLRLGQPATELSGGEAQRIKLATELRRSGR---GGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVA 818
22 -16.3001g6h_A mol:protein length:257 HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANS  ali model follow..  16  8LRTENIVKYEFKALDGVSISVNKGVTLIIGPNGSGKSTLINVIT----------------FLKADEGRVYFENKDITNKEPAELYHY-------------------------------------------------IVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYD--------------------------------------------------------------RKAGELSGGQMKLVEIGRALMT------NPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYV............. 225
23 -16.2003zqj_A mol:protein length:993 UVRABC SYSTEM PROTEIN A  ali model follow..  18  636...RQLTVVGARNLRGIDVSFPLGLTSVTGVSGSGKSTLVNDILAA-----------------------------VLANRLNGARQVPGRHTRVTGLDYLDKLVRVDQSPIGRTPRSNPATYTGVFDKIRTFAATTEAKVRGYQPGRFSFNVKGGRCEACTGDGTIKIEMNFLPDVYVPCEVCQGARYNRETLEVHYKGKTVSEVLDMSIEEAAEFFEP----------------------IAGVHRYLRTLVDVGLGYVRLGQPAPTLSGGEAQRVKLASELQKR--STGRT-VYILDEPTTGLHFDDIRKLLNVINGLVDKGNTVIVIEHNLDVIKTSDWIIDLGPEGGAGGGTVVA 941
24 -15.9001vpl_A mol:protein length:256 ABC transporter, ATP-binding protein  ali model follow..  16  10VVVKDLRIGKKEILKGISFEIEEGIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVE---------------------------------------------------------------------------EPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEK-----------------------------------------------------------------IKDRVSTYSKGMVR------KLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIAL------HNGTIVE 220
25 -15.8003ux8_A mol:protein length:670 Excinuclease ABC, A subunit  ali model follow..  17  320...RWLEVVGARNLKNVSVKIPGTFVAVTGVSGSGKSTLVNEVLYKALAQKLHRAKAKPGEHRDIRGLEHLDKVIDIDQS---------------------------------PIGRTPRSNPATYTGVFDDIRDVFASTNEAKV---SFNVKGGRCEACHGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLDMTVEDALDFFAS----------------------IPKIKRKLETLYDVGLGYMKLGQPATTLSGGEAQRVKLAAELHRR--SNGRT-LYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVA 625
26 -15.8001f3o_A mol:protein length:235 HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROT  ali model follow..  19  2.....IKLKNVTKLKNVNLNIKEGFVSIMGPSGSGKSTMLNII---------------------GCLDKPTEGEVYIDNIK-----------------------------TNDLDDDELTKIRRDKIGF--------------------------VFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEERFANHK--------------------------------------------------------NQLSGGQQQ------RVAIARALANNPPIILADEPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVARFGERIIYLK............ 219
27 -15.7001yqt_A mol:protein length:538 RNase l inhibitor  ali model follow..  19  12SHMEQLEEDCVHRYGYRLPVVKEGMVVIVGPNGTGKSTAVKILAGQLIPNLCGDNDSWDGVIR-----------------------------------------AFRGNELQNYFEKLKNGEIRPVVKPQYVDLIPKAVKGKVIELLKKADETGKLEEVVKALELENVLEREIQHL---------------------------------------------------------------------------------------------SGGELQRVAIAAALLR------NATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDLAVLDYLSDIIHV............. 224
28 -15.7003tif_A mol:protein length:235 Uncharacterized ABC transporter ATP-binding p  ali model follow..  19  2.....VKLKNVTKLKNVNLNIKEGFVSIMGPSGSGKSTMLNII---------------------GCLDKPTEGEVYIDNIK-----------------------------TNDLDDDELTKIRRDKIGF--------------------------VFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEERFANHK--------------------------------------------------------NQLSGGQQQ------RVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVARFGERIIYLK............ 219
29 -15.6002r6f_A mol:protein length:972 Excinuclease ABC subunit A  ali model follow..  17  622...RWLEVVGARNLKNVSVKIPLGFVAVTGVSGSGKSTLVEVLYKALAQKLHRAKAKPGEHRDIRG--------LEHLDKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNEAKVRGYKKGRFSFNV---------------------KGGRCEACHGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLDMTVEDALDFFAS----------------------IPKIKRKLETLYDVGLGYMKLGQPATTLSGGEAQRVKLAAELHRRSN----RTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVA 927
30 -15.6002onk_A mol:protein length:240 Molybdate/tungstate ABC transporter, ATP-bind  ali model follow..  20  1MFLKVRAEKRLGNFRNVDFEMGRDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPERRGIGFVPQ---------------------------------------------------DYALFPHLSVYRNIAYGLRNVERVERDRRVREMAEKLGIAHLLD--------------------------------------------------------------------------------------------RKPARLSGGERQ------RVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDPILHVTHDLIEAAMLADEVAVMLNGRIVEK.... 208
31 -15.5002d2e_A mol:protein length:250 SufC protein  ali model follow..  14  1..MSQLEIRDLWALKGVNLVVPKGVHALMGPNGAGKSTLGKILA--------------------------------------------------------------------------------GDPEYTVERGEILLDGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNE----------------------------------------------------FSGGEKK------RNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYI................... 209
32 -15.5002iw3_A mol:protein length:986 ELONGATION FACTOR 3A  ali model follow..  22  428...EDLCNCEFS-LNKTQLRLKRARRYICGPNGCGKSTLMRAIANGQVDGFPTQEE--------------CRTVY-----------------------------------------------------VEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLI-------------------------------------------------------------------------------------------EFGFTDEMIAMPISALSGGWKM------KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCG---ITSITISHDSVFLDNCEYIINYE............ 613
33 -15.4003ozx_A mol:protein length:538 RNase L inhibitor  ali model follow..  13  10.........KVNGFKLFGLPTPKNILGVLGKNGVGKTTVLKILVKELLNMTNLWNKDANILSGGGLQRLLVAASLLREADVYIFDQPSSYLDVRERMNMAKAIRELLKNKYVIVVDHDLI-VLDYLTDLIHIIYGESSVYGRVSKSYAARVGINNFLKGYLPAENMKIRPDEIKFMLKEVSDLDLSKDLKTKMKWTKIIKKLGDFQLVTPEKQILSYKPQRIFPNYDGTVQQYLENASKDALSTSSWFFEEVTKRLNLHRLLESNVNDLSGGELQKLYIAATLAK------EADLYVLDQPSSYLDVEERYIVAKAIKRVTRERKVTFIIDHDLSIHDYADRIIVFK............ 460
34 -15.3003j16_B mol:protein length:608 Rli1p  ali model follow..  18  78NLEAHVTHRANSFKLHRLPTPRPGVLGLVGTNGIGKSTALKILAGKQ-------KPNLGRFDDPPEWQEIIK-------------------------------------------------------------------------YFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKSPEDVKR------------------------------------------------IKILQLENVLKRDIEKLSGGELQRFAIGMSCVQ------EADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCI............. 293
35 -15.3003bk7_A mol:protein length:607 ABC transporter ATP-binding protein  ali model follow..  18  84.....ISIVNLAFVLYRLPIVKDGMVVIVGPNGTGKTTAVKILAGQLIPNLCEDNDSWDNVIR-----------------------------------------AFRGNELQNYFERLKNGEIRPVVKPQYVDLLPKAVKGKVRELLKKVDEVGKFEEVVKELELENVLDRELHQL---------------------------------------------------------------------------------------------SGGELQRVAIAAALLR------KAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDYLSDVIHV............. 300
36 -15.1001b0u_A mol:protein length:262 HISTIDINE PERMEASE  ali model follow..  18  7.....LHVIDLHKLKGVSLQARAGVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVA----------------------------------------------------------------DKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKY-------------------------------------------------------------AKVGIDERAQGKYPVHLSGGQQQRVSIARALAM------EPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHV-IFLHQG........ 229
37 -14.7002yz2_A mol:protein length:266 Putative ABC transporter ATP-binding protein  ali model follow..  25  2....RIEVVNVKALENVSLVINEGCLLVAGNTGSGKSTLLQIV--GLIEPTSGDVLYDGERKKGYEIRRNIGIAFQYPEDQ---------------------FFAERVFDEVAFAVKNFYPDRDPVPLVKKAMEFVGLDFDSF----------------------------------------------------------------------------------------------------------------------KDRVPFFLSGGEKRRVAIASVIVH------EPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDETVINHVDRVVVLEK........... 213
38 -14.6003gd7_A mol:protein length:390 Fusion complex of Cystic fibrosis transmembra  ali model follow..  20  19....QMTVKDLTILENISFSISPGRVGLLGRTGSGKSTLLSAFL----------LNTEGEIQIDGVSWDSITLEQWRKAFGVIPQKVFIFSGT----------------------------FRKNLDPNAAHSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCV-----------------------------------------------------------------------------------------------------LSHGHKQLMCLA------RSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFAD-CTVILCEARIEAMLECDQFLVIE............ 227
39 -14.6002olj_A mol:protein length:263 Amino acid ABC transporter  ali model follow..  18  19IDVHQLKFGSLEVLKGINVHIREGVVVVIGPSGSGKSTFLRCLNLLEDFDEGEIIIDGINLKAKDTNLNKVREEVGMVFQRFNL-----------------------------------------------FPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDS-----------------------------------------------------------------------------------------LSGGQAQRVAIARALAM------EPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRV-LFMDGG........ 229
40 -14.4003pih_A mol:protein length:916 UvrABC system protein A  ali model follow..  19  588...ASLKIKGVRNLKNIDVEIPLGFVCVTGVSGSGKSSLVMETLYPALMNLLHKTKLPA------GEFDSIE--HENIDKMIAIDQSPIGRTPRSNPATYTKVFDEIRSLFAMTPAAKARGYNKSRFSFNL---------------------KGGRCEACQGQGYVKIEMLFLPDVYVECDVCKGKRYNRETLEITYKGKNISDILDMTVDEALEF-----------------------KNIPSIKRTLQVLHDVGLGYVKLGQPATTLSGGEAQRIKLASELRKR---DTGRTLYILDEPTVGLHFEDVRKLVEVLHRLVDRGNTVIVIEHNLDVIKNADHIIDLGPEGGKEGGYIVA 893
41 -14.2003tui_C mol:protein length:366 Methionine import ATP-binding protein MetN  ali model follow..  17  15IKLSNIT-RTIQALNNVSLHVPAGIYGVIGASGAGKSTLIRCV---------------NLLERPTEGSVLVD--------------------------------GQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSN-----------------------------------------------------------------------------------------LSGGQKQRVAIARALA------SNPKVLLCDQATSALDPATTRSILELLKDINRRLGTILLITHEMDVVKRICDCVAV............. 226
42 -14.1003d31_A mol:protein length:348 Sulfate/molybdate ABC transporter, ATP-bindin  ali model follow..  18  2IEIESLS-RKWKNFDNLSLKVESGYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSPEKHDIAFVYQ----NYSL-----------------------------------------------------------------------------HMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHL-----------------------------------------------------------------LDRNPLTLSGGEQQ------RVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKTVLHITHDQTEARIMADRIAVVMDGKLIQV.... 209
43 -14.1002ff7_A mol:protein length:247 Alpha-hemolysin translocation ATP-binding pro  ali model follow..  25  19.............LDNINLSIKQGEVIIVGRSGSGKSTLTKLI-------------------------------YIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSV-----------------------------EKVIYAAKLAGAHDFISELREGYNTIVGEQGAG------------------------------------------------------------------------------LSGGQRQ------RIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKG-RTVIIIAHRLSTVKNADRIIVMEK........... 212
44 -14.0001mv5_A mol:protein length:243 Multidrug resistance ABC transporter ATP-bind  ali model follow..  27  140............................................................................................................................................................................................................................................................................ISGGQRQ------RLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKG-RTTLVIAHRLSTIVDADKIYFIE............ 211
45 -13.8003gfo_A mol:protein length:275 Cobalt import ATP-binding protein cbiO 1  ali model follow..  17  3LEDYILKVEELHALKGINMNIKRGEVTILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDYSRKGRESIGIVFQDPDNQL----------------------------------------------SASVYQDVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLK-----------------------------------------------------------------------------------------------DKPTHCLSFGQKKRVAIAGVLVM------EPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGTIIIATHDDIVPLYCDNVFVMK............ 218
46 -13.6002ghi_A mol:protein length:260 transport protein  ali model follow..  29  156............................................................................................................................................................................................................................................................................LSGGERQ------RIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKN-RTLIIIAHRLSTISSAESIILLN............ 227
47 -13.6001jj7_A mol:protein length:260 PEPTIDE TRANSPORTER TAP1  ali model follow..  20  15VQFQDVSFADVLVLQGLTFTLRPGEVTLVGPNGSGKSTVAA----------------------------LLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQ----------------------------KPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQ------------------------------------------------------------------------------LSGGQRQ------AVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYRSVLLITQHLSLVEQADHILFLE............ 228
48 -13.5001xmi_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model follow..  20  41LSFSNFSLLGTPVLKDINFKIERGQLLVAGSTGAGKTSLLMMIM---------------GELEPSEGKIKHSGRISFCSQFSWIMPGTIKE------------------------------------------NIIAGVSYDEYRYRSVIKA---------------QLEEDISKFAEKDNIVLGE--------------------------------------------------------------------------------ITLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 233
49 -13.5002bbs_A mol:protein length:290 Cystic fibrosis transmembrane conductance reg  ali model follow..  19  41LSFSNFSLLGTPVLKDINFKIERGQLLVAGSTGAGKTSLLMMIM---------------GELEPSEGKIKHSGRISFCSQNSWIMPGTIK-----------------------------------------------------ENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEG-----------------------------------------------------------------------------------ITLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 232
50 -13.5002ixe_A mol:protein length:271 ANTIGEN PEPTIDE TRANSPORTER 1  ali model follow..  21  17VKFQDVSFANVQVLQGLTFTLYPGKVTLVGPNGSGKSTVAA----------------------------LLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIA------------------------------LTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQ------------------------------------------------------------------------------LSGGQRQ------AVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWARTVLLITQQLSLAERAHHILFLK............ 230
51 -13.4002bbo_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model follow..  19  41LSFSNLSLLGTPVLKDINFKIERGQLLVAGSTGAGKTSLLMMIM---------------GELEPSEGKIKHSGRISFCSQFSWIMPGTIKE------------------------------------------NIIFGVSYDEYRYRSVIKA---------------QLEEDISKFAEKDNIVLGE--------------------------------------------------------------------------------ITLSEGQQAKISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 233
52 -13.2001z47_A mol:protein length:355 putative ABC-transporter ATP-binding protein  ali model follow..  20  8IEFVGVEKIGARSVRGVSFQIREGMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPPQKRNVGLVFQN-----------------------------------------------ALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYA-----------------------------------------------------------------------------------------------NRFPHELSGGQQQ------RVALARALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDEMGTSVFVTHDQEEALEVADRVLVLHEGNVEQF.... 220
53 -13.2003fvq_A mol:protein length:359 Fe(3+) ions import ATP-binding protein fbpC  ali model follow..  21  5LHIGHLSFQNTPVLNDISLSLDPGILFIIGASGCGKTTLLRCL-------AGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQ-------------------------------------VLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELA-----------------------------------------------------------------------------------------------GRYPHELSGGQQQ------RAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGSAVFVSHDREEALQYADRIAVMKQGRILQT.... 220
54 -13.1001q3h_A mol:protein length:286 Cystic fibrosis transmembrane conductance reg  ali model follow..  21  36SDENNVSFSHLCLLKNINLNIEKGEMLITGSTGSGKTSLLMLIL---------------GELEASEGIIKHSGRVSFCSQFSWIMPGTIKE------------------------------------------NIIFGVSYDEYRYKSVVKA---------------QLQQDITKFAEQDNTVLGE--------------------------------------------------------------------------------VTLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILH............ 233
55 -13.0002pzg_A mol:protein length:241 Cystic fibrosis transmembrane conductance reg  ali model follow..  21  18....EVVMENVT-LKDINFKIERGQLLVAGSTGAGKTSLLMMIM---------------GELEPSEGKIKHSGRISFCSQFSWIMPGTIKE------------------------------------------NIIFGVSYDEYRYRSVIKA---------------QLEEDISKFAEKDNIVLGE--------------------------------------------------------------------------------ITLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 215
56 -12.7002cbz_A mol:protein length:237 MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1  ali model follow..  20  1..MNSITVRNAT-LNGITFSIPEGALVVVGQVGCGKSSLLSALL---------------AEMDKVEGHVAIKGSVAYVPQQAWIQNDSLR---------------------------------ENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVN-----------------------------------------------------------------------------------------------------LSGGQKQRVSLA------RAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKTRILVTHSMSYLPQVDVIIVMS............ 202
57 -12.6003nh6_A mol:protein length:306 ATP-binding cassette sub-family B member 6, m  ali model follow..  19  64.............LQDVSFTVMPGQTLLVGPSGAGKSTILRLLF------------------------------YDISSGCIRIDGQDISQVTQASLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGN-----------------------------DEVEAAAQAAGIHDAIMAFPEGYRTQVGERGLK------------------------------------------------------------------------------LSGGEKQ------RVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCAN-RTTIVVAHRLSTVVNADQILVIKVERGRHE-ALLS 271
58 -12.1001ji0_A mol:protein length:240 ABC transporter  ali model follow..  19  7LEVQSLHVYAIHAIKGIDLKVPRGIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVI-NRMGIALVPEGRRIFPELT-----------------------------------------------------YENLMMGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLG-------------------------------------------------------------------------------------GTLSGGEQQM------LAIGRALMSRPKLLMMDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYV-LETGQIVLE... 220
59 -12.1001oxs_C mol:protein length:353 ABC transporter, ATP binding protein  ali model follow..  23  1..MVRIIVKNVSKLDNVNINIENGRFGILGPSGAGKTTFMRIIA--------------------------------------------LDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWA----------------------------LYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVL-----------------------------------------------------------------NHFPRELSGGQQQ------RVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGTLLVVSHDPDIFAIADRVGVLV............ 215
60 -11.8004aa3_A mol:protein length:619 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model follow..  19  373LEFKNVHFAEVPIFQDFSLSIPSGSVTLVGPSGSGKSTVLSLLL------------------------------YDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIA--------------------------YGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVL------------------------------------------------------------------------------LSGGQKQ------RIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDG-RTVLVIAHHLSTIKNANMVAVLDTEYGKHE-ELLS 601
61 -11.6002yl4_A mol:protein length:595 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model follow..  19  342LEFKNVHFAEVPIFQDFSLSIPSGSVTLVGPSGSGKSTVLSLLL------------------------------YDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIA--------------------------YGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVL------------------------------------------------------------------------------LSGGQKQ------RIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDG-RTVLVIAHRLSTIKNANMVAVLDTEYGKHE-ELLS 570
62 -11.4003n73_A mol:protein length:251 Putative 4-hydroxy-2-oxoglutarate aldolase  ali model follow..  15  168............................................................................................................................................................................................................................................................................GLAHEEEYRAVAKACAEE----------FALEPTGGIDKENFETIVRIALEANVERVIPHVYSSIIDKETGNTKVEDVR............ 237
63 -11.4002yyz_A mol:protein length:359 Sugar ABC transporter, ATP-binding protein  ali model follow..  17  1..MPSIRVVNLKKVDGVSFEVKDGFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPKYREVGMVFQN----YALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLL--IDNLLD---------------------------------------------------------------------------------------------------------------------------------------RKPTQLSGGQQQ------RVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGTSVYVTHDQEAMTMASRIAVFN............ 208
64 -11.3003b5x_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  19  341....EVDVKDVT-LSHVSFSIPQGKTVLVGRSGSGKSTIANLF-------------------------------YDVDSGSICLDGHDVRDYKLTNLRRH----------------------------FALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTS------------------------------------------------------------------------------LSGGQRQRVAIA------RALLRDAPVLILDEATSALDTESERAIQAALDELQKN-KTVLVIAHRLSTIEQADEILVVDIERGRHA-DLLA 567
65 -11.3002it1_A mol:protein length:362 362aa long hypothetical maltose/maltodextrin  ali model follow..  22  1..MVEIKLENIVKLNNINLKIKDGFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDRNVGLVFQN----WALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLH--IDKLLN---------------------------------------------------------------------------------------------------------------------------------------RYPWQLSGGQQQ------RVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGTTVYVTHDQEALAMADRIAVIR............ 208
66 -11.2003g5u_A mol:protein length:1284 Multidrug resistance protein 1a  ali model follow..  19 1030....NVQFSGVV-LQGLSLEVKKGQTLLVGSSGCGKSTVVQLL-------ERFYDPMAGSVFLDGKEIKQLNVQW----------------------------------------RAQLGIVSQ---------EPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQ------------------------------------------------------------------------------LSGGQKQ------RIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREG-RTCIVIAHRLSTIQNADLIVVIQKEHGTHQ-QLLA 1258
67 -11.2002d62_A mol:protein length:375 multiple sugar-binding transport ATP-binding  ali model follow..  21  2IGMAEVKLINIWKVKDLSLEIKDGFLVLLGPSGCGKTTTLRMIA----------------LEEPTRGQIYIEDNLVADPEK----------------------------VFVPPKERDVAMVFQSYA----------------------------LYPHMTVYDNIAFPLKLRKVPKQEIDKRVREVAEMLGLTEL------------------------------------------------------------------NRKPRELSGGQRQ------RVALGRAIIRRPKVFLMDEPLSNLDAKLRVKMRAELKKLQRQLGTTIYVTHDQEAMTMGDRIAVMN............ 217
68 -10.9003b5w_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  19  341....DVEFRNVT-LRNINLKIPAGKTVLVGRSGSGKSTIASLI-------------------------------YDIDEGEILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEQYSREQIEEAA----------------------------RMAYAMDFINKMDNGLDTVIGENGVL------------------------------------------------------------------------------LSGGQRQRIAIA------RALLRDSPILILDEATSALDTESERAIQAALDELQKN-RTSLVIAHRLSTIEKADEIVVVEVERGTHN-DLLE 567
69 -10.9001g29_1 mol:protein length:372 MALTOSE TRANSPORT PROTEIN MALK  ali model follow..  20  1..MAGVRLVDVWKVREMSLEVKDGFMILLGPSGCGKTTTLRMIA----------------LEEPSRGQIYIGDKLVADPEK----------------------------IFVPPKDRDIAMVFQSYA----------------------------LYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTEL------------------------------------------------------------------NRKPRELSGGQRQ------RVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGTTIYVTHDQEAMTMGDRIAVMN............ 214
70 -10.9003b5y_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  18  341....DLEFRNVT-LRNINLKIPAGKTVLVGRSGSGKSTIASLI-------------------------------YDIDEGHILMDGHDLREYTLASLRN----------------------------QVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL------------------------------------------------------------------------------LSGGQRQRIAIA------RALLRDSPILILDEATSALDTESERAIQAALDELQKN-RTSLVIAHRLSTIEQADEIVVVEVERGTHS-ELLA 567
71 -10.8001vci_A mol:protein length:373 sugar-binding transport ATP-binding protein  ali model follow..  20  8IKMVEVKLENLTKVNKLNLTIKDGFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQS----YAVWPHMTVYENIAFPLKIKKFPKDEIDKRVRWAAELLQ--IEELLN---------------------------------------------------------------------------------------------------------------------------------------RYPAQLSGGQRQ------RVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKTTIYVTHDQEAMTMGDRIAVMN............ 217
72 -10.6001q12_A mol:protein length:381 Maltose/maltodextrin transport ATP-binding pr  ali model follow..  21  1..MASVQLQNVTKSKDINLDIHEGFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQS----YALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ--LAHLLD---------------------------------------------------------------------------------------------------------------------------------------RKPKALSGGQRQ------RVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGTMIYVTHDQEAMTLADKIVVLD............ 208
73 -10.4002hyd_A mol:protein length:578 ABC transporter homolog  ali model follow..  20  339....RIDIDHVS-LKDINLSIEKGETVFVGMSGGGKSTLINLI-------------------------------YDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATD-----------------------------EEVVEAAKMANAHDFIMNLPQGYDTEVGERGVK------------------------------------------------------------------------------LSGGQKQRLSIA------RIFLNNPPILILDEATSALDLESESIIQEALDVLSKD-RTTLIVAHRLSTITHADKIVVIEVETGTHR-ELIA 564
74 -9.4201grq_A mol:protein length:178 CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE  ali model follow..  18  1....................MTTRMIILNGGSSAGKSGIVRCLQSVL........................................................................................................................................................................................................................................................................................................................ 27

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]