current user: public




Query: 3qkr_B mol:protein length:179 DNA double-strand break repair rad50 ATPase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVSLast
1 -80.9003qkr_B mol:protein length:179 DNA double-strand break repair rad50 ATPase  ali model  100  1AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 179
2 -50.7003qkt_A mol:protein length:339 DNA double-strand break repair rad50 ATPase  ali model   90  164...DKFETAYKKLSELKGGSGGTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 339
3 -48.4003qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase  ali model   93  182.NRIKEYGGSGGIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 359
4 -46.9003kta_B mol:protein length:173 Chromosome segregation protein smc  ali model   24  1.............................MEKEKKNVFMRTFEAISRNFSEIFAKLSPGGSARLILENPEDGLEIEAKPAGKDKRIEAMSGGEKALTALAFVFAI--QKFKPAPFYLFDEIDAHLDDANVKRVADLIKESSKE-SQFIVITLRDVMMANADKIIGVSMRDGVSKVVSLS 152
5 -42.9001w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1  ali model   19  232EAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKGGNASLTIEDENAGIKYHATPPLKRKDMEYLSGGEKTVAALALLFAINSY--QPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQENSSKIITLD 424
6 -39.7001e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN  ali model   19  128..VDFYSIVGQGQIDRIVNASPEELRLESSKHPTSLVPRGSYQRVNESFNRFISLLFFGGEGRLNISILDAGFEISIRKPGRRQKLSLLSGGEKALVGLALLFAL--MEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKH-TQFIVITHNKIVMEAADLLHGVTMVNGVSAIVPVE 307
7 -28.6003aux_A mol:protein length:371 DNA double-strand break repair rad50 ATPase  ali model   30  188YKEESLKARLKEMSNLEKEKEKLTKFVEYLDKVRRIFGRNGFQAYLPLIQKYLNEAFSEFDLPYSFVELTKDFEVRVHAPNGVLTIDNLSGGEQIAVALSLRLAIANALINRVECIILDEPTVYLDENRRAKLAEIFRKV-KSIPQMIIITHHRELEDVADVIINVKKDGNVSKVKI.. 369
8 -26.3003zqj_A mol:protein length:993 UVRABC SYSTEM PROTEIN A  ali model   19  428GTRLKPEILAVTLAGESKGEHGAKS----IAEVCELSIADCADFLNALTLGPREQAIAGQVLKEIRSRLGFLLDVGLEYLSLSRAAATLSGGEAQRIRLATQIGSGLVGV----LYVLDEPSIGLHQRDNRRLIETLTRLRDLGNTLIVVEHDEDTIEHADWIVDIGPGAGEHGGRIVH 598
9 -26.0003pih_A mol:protein length:916 UvrABC system protein A  ali model   29  740..............DVCKGKRYNRETLEI--TYKGKNISDILDMTVDEALEFFKNIPS------IKRTLQVLHDVGLGYVKLGQPATTLSGGEAQRIKLASELR----RDTGRTLYILDEPTVGLHFEDVRKLVEVLHRLVDRGNTVIVIEHNLDVIKNADHIIDLGPEGGKEGGYIVA 893
10 -25.7002pcj_A mol:protein length:224 Lipoprotein-releasing system ATP-binding prot  ali model   24  94.........................................IPELTALENVIVPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELSGGEQQ------RVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAELTHRTLEM............. 212
11 -24.9002r6f_A mol:protein length:972 Excinuclease ABC subunit A  ali model   19  398.RETSSDYIREQMEKYMAEQKKESLAVLVGGKHIGEVTAMSVTEALAFFDGLELTEKEAQIARLILREIRDRLNVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSRLTGV----LYVLDEPSIGLHQRDNDRLIATLKSMRDLGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVA 585
12 -24.4003ux8_A mol:protein length:670 Excinuclease ABC, A subunit  ali model   23  136...........................KHIGEVTAMSVTEALAFFDGLELTEKEAQIARLILREIRDRLGFLQNVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSRLTGV----LYVLDEPSIGLHQRDNDRLIATLKSMRDLGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVA 283
13 -24.1001l7v_C mol:protein length:249 Vitamin B12 transport ATP-binding protein btu  ali model   16  39.....KSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHLRHAHRAWLLK............ 207
14 -24.0002vf7_A mol:protein length:842 EXCINUCLEASE ABC, SUBUNIT A.  ali model   24  668.................HGTRYNAETLEV--EYRGKNIADVLALTVDEAHDFFAD------ESAIFRALDTLREVGLGYLRLGQPATELSGGEAQRIKLATELRRSG---RGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVA 818
15 -23.7001yqt_A mol:protein length:538 RNase l inhibitor  ali model   28  146.................................................................................LEREIQHLSGGELQRVAIAAALLR------NATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDLAVLDLSDIIHVVYGEPGVYGI.... 234
16 -23.5003tho_A mol:protein length:382 Probable DNA double-strand break repair Rad50  ali model   16  203GAGGAGGSLEKKLKEMSDEYNNLDLLRKYLFDKSNFSRYFTGRVLEAVLKRTKAYLDILTNGRFDIDFDDEKGGFIIKDWGIERPARGLSGGERALISISLAMSLAEVASGRLDAFFIDEGFSSLCTENKEKIASVLKELERLNKVIVFITCDREFSEAFDRKLRITGGVVVNE..... 376
17 -22.9003bk7_A mol:protein length:607 ABC transporter ATP-binding protein  ali model   28  222.................................................................................LDRELHQLSGGELQRVAIAAALLR------KAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDLSDVIHVVYGEPGVYGIFS.. 312
18 -22.8001f3o_A mol:protein length:235 HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROT  ali model   20  70..........NDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVE--LPLIFKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQ------RVAIARALANNPPIILADEPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVARFGERIIYL............. 218
19 -22.7003j16_B mol:protein length:608 Rli1p  ali model   31  215.................................................................................LKRDIEKLSGGELQRFAIGMSCVQ------EADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDLSDFVCII............. 294
20 -22.7003tif_A mol:protein length:235 Uncharacterized ABC transporter ATP-binding p  ali model   20  70..........NDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVE--LPLIFKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQ------RVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVARFGERIIYL............. 218
21 -22.2002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model   25  122.................................................................................AKREFTSLSGGQRQLILIARAIA------SECKLILLDEPTSALDLANQDIVLSLLIDLQSQNMTVVFTTHQNQVVAIANKTLLLN............ 203
22 -22.1003ozx_A mol:protein length:538 RNase L inhibitor  ali model   32  379.................................................................................LESNVNDLSGGELQKLYIAATLA------KEADLYVLDQPSSYLDVEERYIVAKAIKRVTRERKVTFIIDHDLSIHDIADRIIVFK............ 460
23 -21.6002ihy_A mol:protein length:279 ABC transporter, ATP-binding protein  ali model   28  149.................................................................................AQQYIGYLSTGEKQRVMIA------RALMGQPQVLILDEPAAGLDFIARESLLSILDSLSDSYPAMIYVTHFEEITANFSKILLLK............ 231
24 -21.5001sgw_A mol:protein length:214 putative ABC transporter  ali model   24  120................................................................................DLKKKLGELSQGTIRRVQLASTL------LVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSRE--ELSYCDVNENLH............ 198
25 -21.2002yz2_A mol:protein length:266 Putative ABC transporter ATP-binding protein  ali model   38  132.................................................................................KDRVPFFLSGGEKRRVAIASVIVH------EPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDETVINHVDRVVVLE............ 212
26 -20.7001b0u_A mol:protein length:262 HISTIDINE PERMEASE  ali model   24  120......................................................QVLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAM------EPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFAHVSSHVIFLH............ 227
27 -20.7002pjz_A mol:protein length:263 Hypothetical protein ST1066  ali model   25  115..........................................................................LKLGEEILRRKLYKLSAGQSVLVRTSLALA------SQPEIVGLDEPFENVDAARRHVISRYIKEY---GKEGILVTHELDMLNLYKEYKAYFLVGN........ 202
28 -20.1002olj_A mol:protein length:263 Amino acid ABC transporter  ali model   27  152......................................................................................DSLSGGQAQRVAIARALAM------EPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAEVGDRVLFMD............ 227
29 -20.1003gfo_A mol:protein length:275 Cobalt import ATP-binding protein cbiO 1  ali model   22  108....................................................FGAVNMKLPEDEIRKRVDNALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVM------EPKVLILDEPTAGLDPMGVSEIMKLLVEMKELGITIIIATHDDIVPLYCDNVFVMK............ 218
30 -20.0002zu0_C mol:protein length:267 Probable ATP-dependent transporter sufC  ali model   23  160........................................................................................FSGGEKKRNDILQMAVL------EPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQG........ 236
31 -19.8001vpl_A mol:protein length:256 ABC transporter, ATP-binding protein  ali model   18  72..............NVVEEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFY-----ASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARAL------MVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSH-LEVEFLCDRIALIH............ 214
32 -19.8002iw3_A mol:protein length:986 ELONGATION FACTOR 3A  ali model   26  528.........................................................................EFGFTDEMIAMPISALSGGWKM------KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCG----TSITISHDSVFLDVCEYIINYE............ 613
33 -19.1002onk_A mol:protein length:240 Molybdate/tungstate ABC transporter, ATP-bind  ali model   26  105..................................................................RRVREMAEKLGIAHLLDRKPARLSGGERQRVALA------RALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDPILHVTHDLEAAMLADEVAVML............ 201
34 -19.1001mv5_A mol:protein length:243 Multidrug resistance ABC transporter ATP-bind  ali model   27  139.......................................................................................KISGGQRQ------RLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMK-GRTTLVIAHRLSTIVDADKIYFIE............ 211
35 -19.0001g6h_A mol:protein length:257 HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANS  ali model   14  127.............................................................EEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIG------RALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDVLNYIDHLYVMF............ 227
36 -18.8002ff7_A mol:protein length:247 Alpha-hemolysin translocation ATP-binding pro  ali model   33  140........................................................................................LSGGQRQ------RIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHRLSTVKNADRIIVME............ 211
37 -18.5001jj7_A mol:protein length:260 PEPTIDE TRANSPORTER TAP1  ali model   26  153......................................................................................SQLSGGQRQ------AVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERSRSVLLITQHLSLVEQADHILFLE............ 228
38 -18.5002ghi_A mol:protein length:260 transport protein  ali model   29  156........................................................................................LSGGERQ------RIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRK-NRTLIIIAHRLSTISSAESIILLN............ 227
39 -18.4002ixe_A mol:protein length:271 ANTIGEN PEPTIDE TRANSPORTER 1  ali model   26  155......................................................................................NQLSGGQRQ------AVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWSRTVLLITQQLSLAERAHHILFLK............ 230
40 -17.9002d2e_A mol:protein length:250 SufC protein  ali model   18  144........................................................................................FSGGEKKRNEILQLLVL------EPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILN..................... 207
41 -17.3003n73_A mol:protein length:251 Putative 4-hydroxy-2-oxoglutarate aldolase  ali model   15  168........................................................................................GLAHEEEYRAVAKACAEE----------FALEPTGGIDKENFETIVRIALEANVERVIPHVYSSIIDKETGNTKVEDVR............ 237
42 -17.0003nh6_A mol:protein length:306 ATP-binding cassette sub-family B member 6, m  ali model   25  185........................................................................................LSGGEKQRVAIA------RTILKAPGIILLDEATSALDTSNERAIQASLAKVCA-NRTTIVVAHRLSTVVNADQILVIKVERGRHE..... 267
43 -16.9003fvq_A mol:protein length:359 Fe(3+) ions import ATP-binding protein fbpC  ali model   25  90.......................................VLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRAALA------RALAPDPELILLDEPFSALDEQLRRQIREDMIAALRAGKSAVFVSHDREALQYADRIAVMK............ 213
44 -16.8003d31_A mol:protein length:348 Sulfate/molybdate ABC transporter, ATP-bindin  ali model   25  106..................................................................KRVLDTARDLKIEHLLDRNPLTLSGGEQQRVALA------RALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKKLTVLHITHDQEARIMADRIAVVM............ 202
45 -16.7001ji0_A mol:protein length:240 ABC transporter  ali model   21  131...............................................................................ERLKQLGGTLSGGEQQM------LAIGRALMSRPKLLMMDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNLGALKVAHYGYVLE............ 213
46 -16.6001z47_A mol:protein length:355 putative ABC-transporter ATP-binding protein  ali model   22  90.......................................ALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPHELSGGQQQRVALA------RALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDEMGTSVFVTHDQEALEVADRVLVLH............ 213
47 -16.5003tui_C mol:protein length:366 Methionine import ATP-binding protein MetN  ali model   19  132..................................................................RRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALA------SNPKVLLCDQATSALDPATTRSILELLKDINRRLGTILLITHEMDVVKRICDCVAV-ISNG........ 230
48 -16.3002pzg_A mol:protein length:241 Cystic fibrosis transmembrane conductance reg  ali model   28  141......................................................................................ITLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 215
49 -16.1003gd7_A mol:protein length:390 Fusion complex of Cystic fibrosis transmembra  ali model   25  155.......................................................................................VLSHGHKQLMCLA------RSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFAD-CTVILCEARIEAMLECDQFLVI--EEN........ 229
50 -15.9001q3h_A mol:protein length:286 Cystic fibrosis transmembrane conductance reg  ali model   28  159......................................................................................VTLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILH............ 233
51 -15.8002cbz_A mol:protein length:237 MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1  ali model   23  126......................................................................................VNLSGGQKQRVSLA------RAVYSNADIYLFDDPLSAVDAHVGKHIFEIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMS............ 202
52 -15.7001xmi_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model   28  159......................................................................................ITLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 233
53 -15.7002bbs_A mol:protein length:290 Cystic fibrosis transmembrane conductance reg  ali model   28  158......................................................................................ITLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 232
54 -15.6002bbo_A mol:protein length:291 Cystic fibrosis transmembrane conductance reg  ali model   25  159......................................................................................ITLSEGQQAKISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 233
55 -15.5001oxs_C mol:protein length:353 ABC transporter, ATP binding protein  ali model   25  114.............................................................KEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQ------RVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHDPDIFAIADRVGVLV............ 215
56 -14.6002it1_A mol:protein length:362 362aa long hypothetical maltose/maltodextrin  ali model   26  112..................................................................KKVREVAKMLHIDKLLNRYPWQLSGGQQQ------RVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEGITTVYVTHDQEALAMADRIAVIR............ 208
57 -14.6003b5w_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model   18  411....TLASLRNQVALVSQNVHLFNDTVAN---------NIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL-----LSGGQRQRIAIA------RALLRDSPILILDEATSALDTESERAIQAALDELQK-NRTSLVIAHRLSTIEKADEIVVVEVERGTHN..... 563
58 -14.6003b5x_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model   29  479......................................................................................TSLSGGQRQRVAIA------RALLRDAPVLILDEATSALDTESERAIQAALDELQK-NKTVLVIAHRLSTIEQADEILVVDIERGRHA..... 563
59 -14.6003b5y_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model   19  411....TLASLRNQVALVSQNVHLFNDTVAN---------NIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL-----LSGGQRQRIAIA------RALLRDSPILILDEATSALDTESERAIQAALDELQK-NRTSLVIAHRLSTIEQADEIVVVEVERGTHS..... 563
60 -14.5002yyz_A mol:protein length:359 Sugar ABC transporter, ATP-binding protein  ali model   22  112..................................................................KRVVEIARKLLIDNLLDRKPTQLSGGQQQ------RVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQEGITSVYVTHDQEAMTMASRIAVFN............ 208
61 -14.5002yl4_A mol:protein length:595 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model   26  483.......................................................................................LLSGGQKQ------RIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMD-GRTVLVIAHRLSTIKNANMVAVLDTEYGKHE..... 566
62 -14.4004aa3_A mol:protein length:619 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model   26  514.......................................................................................LLSGGQKQ------RIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMD-GRTVLVIAHHLSTIKNANMVAVLDTEYGKHE..... 597
63 -14.3001g29_1 mol:protein length:372 MALTOSE TRANSPORT PROTEIN MALK  ali model   22  118..................................................................QRVREVAELLGLTELLNRKPRELSGGQRQ------RVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQGVTTIYVTHDQEAMTMGDRIAVMN............ 214
64 -14.2002d62_A mol:protein length:375 multiple sugar-binding transport ATP-binding  ali model   22  121..................................................................KRVREVAEMLGLTELLNRKPRELSGGQRQ------RVALGRAIIRRPKVFLMDEPLSNLDAKLRVKMRAELKKLQRQGVTTIYVTHDQEAMTMGDRIAVMN............ 217
65 -14.1001vci_A mol:protein length:373 sugar-binding transport ATP-binding protein  ali model   25  121..................................................................KRVRWAAELLQIEELLNRYPAQLSGGQRQ------RVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKKVTTIYVTHDQEAMTMGDRIAVMN............ 217
66 -14.0001q12_A mol:protein length:381 Maltose/maltodextrin transport ATP-binding pr  ali model   27  112..................................................................QRVNQVAEVLQLAHLLDRKPKALSGGQRQ------RVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQEAMTLADKIVVLD............ 208
67 -13.8003g5u_A mol:protein length:1284 Multidrug resistance protein 1a  ali model   15  458..............NVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERG-----AQLSGGQKQ------RIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKARE-GRTTIVIAHRLSTVRNADVIAGFDVEQGNHD..... 609
68 -13.7002hyd_A mol:protein length:578 ABC transporter homolog  ali model   19  409..............LTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVK-----LSGGQKQRLSIA------RIFLNNPPILILDEATSALDLESESIIQEALDVLSK-DRTTLIVAHRLSTITHADKIVVIEVETGTHR..... 560
69 -11.9002o5v_A mol:protein length:359 DNA replication and repair protein recF  ali model   21  156TVSQRNAALRGGEEWA---MHVWDDVLLKLGTEIMLFRRRALTRLDELAREANAQLGSRKYAADLRGRRAEELARGSTVTGPHRDDLLLSRGEGRTVALALRRALLREKFGEDPVLLLDDFTAELDPHRRQYLLDLAASVPQAIVTGTELAPGAALTLRAQAGRFTPVADE........ 351
70 -11.5003euj_A mol:protein length:483 Chromosome partition protein mukB, Linker  ali model   14  293...NIRDTHSILLNALSDQHEQHKDLFESQKLSFSEALAMLYKRINPHIELGQRMPQTLDYRNYLDLEVETLRGAYGWMRAESSALSTGEAIGTGMSILLMVVQSWEEEILPCRLLFLDQA-ARLDAMSINTLFELCERL-----QLLIAA............................ 449
71 -9.7202r2a_A mol:protein length:199 Uncharacterized protein  ali model   12  86..............................................................................................................NIGSIVIVDEAQDVWPARSAGSNVQWLNTHRHQGIDIFVLTQDQNLRTLVRKHYHIAS........... 152

FFAS is supported by the NIH grant R01-GM087218-01
6 6 1 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Berman HM, Burley SK, Chiu W, Sali A, Adzhubei A, Bourne PE, Bryant SH,Dunbrack RL Jr, Fidelis K, Frank J, Godzik A, Henrick K, Joachimiak A, HeymannB, Jones D, Markley JL, Moult J, Montelione GT, Orengo C, Rossmann MG, Rost B,Saibil H, Schwede T, Standley DM, Westbrook JD. Outcome of a workshop on archiving structural models of biological macromolecules. Structure. 2006 Aug;14(8):1211-7.