current user: public




Query: 3qkr_B mol:protein length:179 DNA double-strand break repair rad50 ATPase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVSLast
1 -80.3003qkr_B mol:protein length:179 DNA double-strand break repair rad50 ATPase  ali model  100  1AEKENRERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 179
2 -47.8003qku_A mol:protein length:359 DNA double-strand break repair rad50 ATPase  ali model follow..  98  190.........SGGIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 359
3 -45.8003qkt_A mol:protein length:339 DNA double-strand break repair rad50 ATPase  ali model follow..  90  163..LDKFETAYKKLSELKGGSGGTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS 339
4 -42.3003zgx_A mol:protein length:426 CHROMOSOME PARTITION PROTEIN SMC  ali model follow..  22  237.VNERYKFLSEQKEDLTEAKNTLFQVIEEMDEEMTKRFNDTFVQIRSHFDQVFRSLFGGGRAELRLTDPHSGVEIIAQPPGKKQNLNLLSGGERALTAIALLFSILKV--RPVPFCVLDEVEAALDEANVFRFAQYLKKYSSD-TQFIVITHRKGTMEEADVLYGVTMESGVSKVISVK 417
5 -41.3001w1w_A mol:protein length:430 STRUCTURAL MAINTENANCE OF CHROMOSOME 1  ali model follow..  19  232EAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKGGNASLTIEDEDEGIKYHATPPLKRKDMEYLSGGEKTVAALALLFAINSY--QPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQENSSKIITLD 424
6 -37.3001e69_A mol:protein length:322 CHROMOSOME SEGREGATION SMC PROTEIN  ali model follow..  20  128..VDFYSIVGQGQIDRIVNASPEELRLESSKHPTSLVPRGSYQRVNESFNRFISLLFFGGEGRLNIVSEDAGFEISIRKPGRRQKLSLLSGGEKALVGLALLFALMEI--KPSPFYVLDEVDSPLDDYNAERFKRLLKENSKH-TQFIVITHNKIVMEAADLLHGVTMVNGVSAIVPVE 307
7 -36.5004ux3_A mol:protein length:543 STRUCTURAL MAINTENANCE OF CHROMOSOMES PROTEIN  ali model follow..  23  309KFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKYTGVSISVSFNSKQNEVEQLSGGQKTVCAIALILAIQMV--DPASFYLFDEIDAALDKQYRTAVATLLKELSKN-AQFICTTFRTDMLQVADKFFRVKYENKISTVIEVN 518
8 -25.8003tho_A mol:protein length:382 Probable DNA double-strand break repair Rad50  ali model follow..  16  211........LEKKLKEMSDEYNNLDLLRKYLFDKSNFSRYFTGRVLEAVLKRTKAYLDILTNGRFDIDFDDEKGGFIIKDWGIERPARGLSGGERALISISLAMSLAEVASGRLDAFFIDEGFSSLCTENKEKIASVLKELERLNKVIVFITCDREFSEAFDRKLRITGGVVVNE..... 376
9 -25.2004i99_A mol:protein length:354 Chromosome partition protein Smc  ali model follow..  22  154MSPLERRLLIDDISGIAEYDSKKEKALEEEKEKKNVFMR-TFEAISRNFSEIFAKLSPGGSARLILENPEDGLEIEAKPAGKDKRIEAMSGGEKALTALAFVFAIQK--FKPAPFYLFDEIDAHLDDANVKRVADLIKESSKE-SQFIVITLRDVMMANADKIIGVSMRDGVSKVVSLS 333
10 -24.2005f3w_B mol:protein length:372 DNA double-strand break repair Rad50 ATPase,D  ali model follow..  32  196ARLKEMSNLEKEKEKLTKFVEYLDKVRRIFGGFQAYLREKYVPLIQKYLNEAFSEFD----LPYSFVELTKDFEVRVHAPNGVLTIDNLSGGEQIAVALSLRLAIANALIGNVECIILDEPTVYLDENRRAKLAEIFRKV-KSIPQMIIITHHRELEDVADVIINVKKDGNVSKVKING 372
11 -24.0002pcj_A mol:protein length:224 Lipoprotein-releasing system ATP-binding prot  ali model follow..  24  94.........................................IPELTALENVIVPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELSGGEQQ------RVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAELTHRTLEMK............ 213
12 -21.0001yqt_A mol:protein length:538 RNase l inhibitor  ali model follow..  28  147..................................................................................EREIQHLSGGELQ------RVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDLAVLDLSDIIHVVYGEPGVYGIFS.. 236
13 -20.9001l7v_C mol:protein length:249 Vitamin B12 transport ATP-binding protein btu  ali model follow..  25  121..................................................................................GRSTNQLSGGEWQRVRLAAVVLITPQANPAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHLRHAHRAWLLK............ 207
14 -20.9004fi3_C mol:protein length:249 Vitamin B12 import ATP-binding protein BtuD  ali model follow..  24  121..................................................................................GRSTNQLSGGEWQRVRLAAVVLITPQANPAGQLLLLDQPMCSLDVAQQSALDKILSALSQQGLAIVMSSHDLNHLRHAHRAWLLK............ 207
15 -20.5003ozx_A mol:protein length:538 RNase L inhibitor  ali model follow..  32  380..................................................................................ESNVNDLSGGELQ------KLYIAATLAKEADLYVLDQPSSYLDVEERYIVAKAIKRVTRERKATFIIDHDLSIHDIADRIIVFK............ 460
16 -20.2003j16_B mol:protein length:608 Rli1p  ali model follow..  27  203.....................................................................KRYIKILQLENVLKRDIEKLSGGELQ------RFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDLSDFVCIIYGVPSVYGVVT.. 305
17 -20.1004g1u_C mol:protein length:266 Hemin import ATP-binding protein HmuV  ali model follow..  22  81...........................KALARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPAVCCVLHDLNLAALADRIMLLA............ 222
18 -19.7003tif_A mol:protein length:235 Uncharacterized ABC transporter ATP-binding p  ali model follow..  25  144......................................................................................NQLSGGQQQ------RVAIARALANNPPIILADQPTWALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVARFGERIIYLK............ 219
19 -19.7001f3o_A mol:protein length:235 HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROT  ali model follow..  26  144......................................................................................NQLSGGQQQ------RVAIARALANNPPIILADEPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHDINVARFGERIIYLK............ 219
20 -19.4002pjz_A mol:protein length:263 Hypothetical protein ST1066  ali model follow..  29  115..........................................................................LKLGEEILRRKLYKLSAGQSV------LVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGK---EGILVTHEDMLNLYKEYKAYFLVGN......... 202
21 -19.3002nq2_C mol:protein length:253 Hypothetical ABC transporter ATP-binding prot  ali model follow..  25  122.................................................................................AKREFTSLSGGQRQLILIA------RAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNTVVFTTHQNQVVAIANKTLLLN............ 203
22 -19.2004hlu_D mol:protein length:268 Energy-coupling factor transporter ATP-bindin  ali model follow..  29  122.....................................................................KKVLELVGLSGLAAADPLNLSGGQKQRLAIASMLAR------DTRFLALDEPVSMLDPPSQREIFQVLESLKNEGKGIILVTHELEYLDDMDFILHIS............ 213
23 -18.8003bk7_A mol:protein length:607 ABC transporter ATP-binding protein  ali model follow..  30  223..................................................................................DRELHQLSGGELQ------RVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDLSDVIHVVYGEPGVYGI.... 310
24 -18.8001sgw_A mol:protein length:214 putative ABC transporter  ali model follow..  23  122..................................................................................KKKLGELSQGTIR------RVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSRE--ELSYCDVNENLHK........... 199
25 -18.7002iw3_A mol:protein length:986 ELONGATION FACTOR 3A  ali model follow..  21  490....RTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKL--------------------------------EFGFTDEMIAMPISALSGGWKM------KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTCG----TSITISHDSVFLDVCEYIINYE............ 613
26 -18.6004hlu_A mol:protein length:268 Putative ABC transporter ATP-binding protein  ali model follow..  37  141........................................................................................LSGGEKRRVAIASVIVH------EPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDETVINHVDRVVVLE............ 214
27 -18.6001b0u_A mol:protein length:262 HISTIDINE PERMEASE  ali model follow..  31  152......................................................................................VHLSGGQQQRVSIARALAM------EPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFRHVSSHVIFLH............ 227
28 -18.3004yms_J mol:protein length:240 ABC-type polar amino acid transport system, A  ali model follow..  28  135......................................................................................IKLSGGQKQ------RLAIARALAMQPEVMLFDEPTSALDPEMVKEVLNVMKQLANEGMTMVVVTHEMGFREVGDRVIFMD............ 210
29 -18.2002onk_A mol:protein length:240 Molybdate/tungstate ABC transporter, ATP-bind  ali model follow..  26  108.....................................................................REMAEKLGIAHLLDRKPARLSGGERQ------RVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDPILHVTHDIEAAMLADEVAVML............ 201
30 -18.0005dgx_A mol:protein length:256 Lipid A export ATP-binding/permease protein M  ali model follow..  30  155.......................................................................................KLSGGQRQ------RISIARALLKNAPVLIFDEATSALDNESERVVQQALESLTKS-CTTIVIAHRLSTVENADKIVVMD............ 227
31 -18.0003gfo_A mol:protein length:275 Cobalt import ATP-binding protein cbiO 1  ali model follow..  20  70.............KPIDYSRKGIMKLRESIGIVFQDPDNQLFSASVYQ-DVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVM------EPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGTIIIATHDDIVPLYCDNVFVMK............ 218
32 -17.9005idv_A mol:protein length:279 Lipid A export ATP-binding/permease protein M  ali model follow..  20  101..............ELSSLRTQIAMVNQQVVLFNRTVRENAYGQLHNASDEDVIAAAKAAYAHDFIMNLPNGYDTVLGAQGLN-----LSGGQRQ------RIAIARAILKNAPILILDEATSALDNESEHFIQQAFDEAMQD-RTTIVIAHRLSTIENADRIVVMD............ 242
33 -17.9003pih_A mol:protein length:916 UvrABC system protein A  ali model follow..  35  801...................................................................................QPATTLSGGEAQRIKLASELR----RDTGRTLYILDEPTVGLHFEDVRKLVEVLHRLVDRGNTVIVIEHNLDVIKNADHIIDLGPEGGKEGGYIVA 893
34 -17.8005eum_A mol:protein length:258 Lipid A export ATP-binding/permease protein M  ali model follow..  35  156.......................................................................................SLSGGQRQ------RLAIARALLRNSPVLILDEATSALDTESERAIQSALEELKKD-RTVVVIAHRLSTIENADEILVID............ 228
35 -17.8002olj_A mol:protein length:263 Amino acid ABC transporter  ali model follow..  27  152......................................................................................DSLSGGQAQ------RVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFREVGDRVLFMD............ 227
36 -17.7002ff7_A mol:protein length:247 Alpha-hemolysin translocation ATP-binding pro  ali model follow..  32  140........................................................................................LSGGQRQ------RIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKG-RTVIIIAHRLSTVKNADRIIVMEKGK......... 214
37 -17.7001vpl_A mol:protein length:256 ABC transporter, ATP-binding protein  ali model follow..  23  122.....................................................................ERATEIAGLGEKIKDRVSTYSKGMVR------KLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSH-LEVEFLCDRIALIH............ 214
38 -17.6004u00_A mol:protein length:244 Amino acid ABC transporter, ATP-binding prote  ali model follow..  28  137......................................................................................AQLSGGQQQRVAIARALAM------EPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEMGFREVADRVVFMD............ 212
39 -17.5005d3m_B mol:protein length:287 Energy-coupling factor transporter ATP-bindin  ali model follow..  35  146........................................................................................LSGGQMRRVALAGVLAY------EPEIICLDEPAAGLDPMGRLEMMQLFKDYQAAGHTVILVTHNDDVADYADDVLALE............ 219
40 -17.5001mv5_A mol:protein length:243 Multidrug resistance ABC transporter ATP-bind  ali model follow..  27  140........................................................................................ISGGQRQ------RLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKG-RTTLVIAHRLSTIVDADKIYFIE............ 211
41 -17.4003zqj_A mol:protein length:993 UVRABC SYSTEM PROTEIN A  ali model follow..  31  849...................................................................................QPAPTLSGGEAQRVKLASELQ-----STGRTVYILDEPTTGLHFDDIRKLLNVINGLVDKGNTVIVIEHNLDVIKTSDWIIDLGPEGGAGGGTVVA 941
42 -17.4003ux8_A mol:protein length:670 Excinuclease ABC, A subunit  ali model follow..  32  192...................................................................................RSAGTLSGGEAQRIRLATQIG----SRLTGVLYVLDEPSIGLHQRDNDRLIATLKSMRDLGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVA 283
43 -17.2004ad8_A mol:protein length:517 DNA REPAIR PROTEIN RECN  ali model follow..  17  292...EFGAQAAEELAGLEEDERDAGSLQADVDALHAELLKVGLDAAREREAEPLVDSLLAVIRELGMPHARMEFALSALAEPAAYGLSDVSGGELSRVMLAVST----VLGADTPSVVFDEVDAGIGGAAAIAVAEQLSRLADT-RQVLVVTHLAQIAARAHHHYKVEKQVEDGRTVS.. 481
44 -17.1002r6f_A mol:protein length:972 Excinuclease ABC subunit A  ali model follow..  30  835...................................................................................QPATTLSGGEAQRVKLAAELH----RSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVA 927
45 -17.0001jj7_A mol:protein length:260 PEPTIDE TRANSPORTER TAP1  ali model follow..  26  153......................................................................................SQLSGGQRQ------AVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRVLLITQHLSLVEQADHILFLE............ 228
46 -17.0002vf7_A mol:protein length:842 EXCINUCLEASE ABC, SUBUNIT A.  ali model follow..  30  726...................................................................................QPATELSGGEAQRIKLATELRRSG---RGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASDWVLDIGPGAGEDGGRLVA 818
47 -16.8004huq_B mol:protein length:279 Energy-coupling factor transporter ATP-bindin  ali model follow..  27  122.....................................................................QAALAQVGMTSFAQREPSSLSGGQKQRVALAGIVAI------APKILILDEATSMLDPQGRIEMLAIVRQLRQQQNTVISITHDIDEAASADRVLVID............ 214
48 -16.8002ixe_A mol:protein length:271 ANTIGEN PEPTIDE TRANSPORTER 1  ali model follow..  26  155......................................................................................NQLSGGQRQ------AVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRVLLITQQLSLAERAHHILFLK............ 230
49 -16.8001g6h_A mol:protein length:257 HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANS  ali model follow..  14  125...........................................................PKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIG------RALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDVLNYIDHLYVMF............ 227
50 -16.8005d7t_A mol:protein length:300 Energy-coupling factor transporter ATP-bindin  ali model follow..  25  133.....................................................................AQAVADVGMADYADSEPSNLSGGQKQRVAIAGILAV------KPQVIILDESTSMLDPEGKEQILDLVRKIKEDNNTVISITHDLEEAAGADQVLVLD............ 225
51 -16.6002ghi_A mol:protein length:260 transport protein  ali model follow..  29  156........................................................................................LSGGERQ------RIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKN-RTLIIIAHRLSTISSAESIILLN............ 227
52 -16.3003fvq_A mol:protein length:359 Fe(3+) ions import ATP-binding protein fbpC  ali model follow..  25  90.......................................VLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQ------RAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGSAVFVSHDREALQYADRIAVMK............ 213
53 -16.2001z47_A mol:protein length:355 putative ABC-transporter ATP-binding protein  ali model follow..  23  90.......................................ALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPHELSGGQQQ------RVALARALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDEMGTSVFVTHDEEALEVADRVLVLH............ 213
54 -16.2004mki_B mol:protein length:298 Energy-coupling factor transporter ATP-bindin  ali model follow..  23  73.............IDITDKKVSLKDIRKQVGLVFQYPEYQLFEETVFKDIAFGPSNLGLSEEEVKERVYEAMEIVGISKELADKSPFELSGGQKRRVAIAGILAM------RPKILILDEPTAGLDPKGKQEILNKIKEIHDKYKITILVSHNEDIARIADKIIVMN............ 222
55 -16.1003vx4_A mol:protein length:273 Putative ABC transporter, ATP-binding protein  ali model follow..  30  172........................................................................................ISGGQKQ------RIALARALLTQAPVLILDAATSSLDILTEKKIISNLLQMTEK--TIIFVAHRLSISQRTDEVIVMD............ 242
56 -16.0004ry2_A mol:protein length:730 ABC-type bacteriocin transporter  ali model follow..  26  626........................................................................................LSEGQKQ------RLAIARALLKKPDILILDEATSNLDSITENHIKDAIYGLEDD-VTVIIIAHRLSTIVNCDKIYLLKVESGSHT..... 708
57 -15.9004huq_A mol:protein length:290 Energy-coupling factor transporter ATP-bindin  ali model follow..  32  146........................................................................................LSGGQMRRVAIAGVLAM------QPKVLVLDEPTAGLDPQGRQEMMRLFARLHQEQGTIVLVTHQEDVAQYAEQVAVMH............ 220
58 -15.7002ihy_A mol:protein length:279 ABC transporter, ATP-binding protein  ali model follow..  28  150..................................................................................QQYIGYLSTGEKQ------RVMIARALMGQPQVLILDEPAAGLDFIARESLLSILDSLSDSTLAMIYVTHFEEITANFSKILLLK............ 231
59 -15.6003d31_A mol:protein length:348 Sulfate/molybdate ABC transporter, ATP-bindin  ali model follow..  26  109.....................................................................LDTARDLKIEHLLDRNPLTLSGGEQQ------RVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKTVLHITHDTEARIMADRIAVVM............ 202
60 -15.6004hzi_A mol:protein length:294 ABC transporter ATP-binding protein  ali model follow..  24  161.................................................................................KDQLYNTLSSGEKK------KILFLRSIVNEPDFLIMDEPCSSLDLTAREDFLGFLKEYHSK-FTSLYITHREEIPDFYSKAVLLK............ 242
61 -15.5003tui_C mol:protein length:366 Methionine import ATP-binding protein MetN  ali model follow..  16  78...DGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA---------LPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQ------RVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGTILLITHEMDVVKRICDCVAV-ISNG........ 230
62 -15.5003b5w_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  20  411...........TLASLRNQVALVSQNVHLFND--TVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENG-----VLLSGGQRQ------RIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKN-RTSLVIAHRLSTIEKADEIVVVEVERGTHN..... 563
63 -15.4003b5x_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  21  411...........KLTNLRRHFALVSQNVHLFND--TIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENG-----TSLSGGQRQ------RVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKN-KTVLVIAHRLSTIEQADEILVVDIERGRHA..... 563
64 -15.4003b5y_A mol:protein length:582 Lipid A export ATP-binding/permease protein m  ali model follow..  21  411...........TLASLRNQVALVSQNVHLFND--TVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENG-----VLLSGGQRQ------RIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKN-RTSLVIAHRLSTIEQADEIVVVEVERGTHS..... 563
65 -15.4002pzg_A mol:protein length:241 Cystic fibrosis transmembrane conductance reg  ali model follow..  28  141......................................................................................ITLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILH............ 215
66 -15.1003j5s_D mol:protein length:561 Energy-dependent translational throttle A (Et  ali model follow..  19  76.QEPQLNPEHTVRESIEEAVSEVVNALKRLDEVYALYADPDADFDKLAAEQGRLEEIIQAHDGHNLNVQLERAADALRLPDWDAKIANLSGGERR------RVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDFEG----VVAITHDRYFLDVAGWILELDRGEGI....... 238
67 -15.1003zdq_A mol:protein length:595 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10,  ali model follow..  27  483.......................................................................................LLSGGQKQ------RIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDG-RTVLVIAHRLSTIKNANMVAVLD............ 555
68 -15.0004yer_A mol:protein length:328 ABC transporter ATP-binding protein  ali model follow..  27  118.....................................................................LELLEFVELLEFKDKPVKTFSGGMAR------RLEIARSLIHEPEVLFLDEPTIGLDPHTRAHMWEYISKMKKEHNMTIFLTYMDEAEQLADRVAIID............ 211
69 -15.0004p31_A mol:protein length:249 Lipopolysaccharide export system ATP-binding  ali model follow..  21  73................ARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLR--------DSMGQSLSGGERR------RVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNRETLAVCERAYIVS............ 210
70 -14.9004ayw_A mol:protein length:619 ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 10  ali model follow..  27  514.......................................................................................LLSGGQKQ------RIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDG-RTVLVIAHHLSTIKNANMVAVLD............ 586
71 -14.8004fwi_B mol:protein length:334 ABC-type dipeptide/oligopeptide/nickel transp  ali model follow..  33  154.......................................................................................QLSGGMKQRVLIALALLL------DPVVLILDEPTSALDVLTQAHIIQLLKELKKMLKTLIFVTHDIAVAELADKVAVI............. 228
72 -14.7001q3h_A mol:protein length:286 Cystic fibrosis transmembrane conductance reg  ali model follow..  28  159......................................................................................VTLSGGQRARISLA------RAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILH............ 233
73 -14.7003nh6_A mol:protein length:306 ATP-binding cassette sub-family B member 6, m  ali model follow..  27  184.......................................................................................KLSGGEKQ------RVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCAN-RTTIVVAHRLSTVVNADQILVIK............ 256
74 -14.6003gd7_A mol:protein length:390 Fusion complex of Cystic fibrosis transmembra  ali model follow..  21  155.......................................................................................VLSHGHKQ------LMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFAD-CTVILCEARIEAMLECDQF--LVIEEN........ 229
75 -14.5005c73_C mol:protein length:564 Protein glycosylation K  ali model follow..  23  447.............................................DAVDEEKLNKVIKQANLEHFIKNLPQGVQTKVGDGGSN-----LSGGQKQ------RIAIARALYLEPEILVLDQATSALDTQSEAKIMDEIYKISKD-KTMIIIAHRLSTITQCDKVYRLE............ 556

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.