current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

3q47B
Query: 3q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GPHMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRLast
1 -75.2003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model  100  1GPHMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR 137
2 -67.7001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  25  7..DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAG.. 139
3 -66.8002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  26  9..DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQK.......... 133
4 -64.5002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  28  22..TPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISGPSS............ 147
5 -64.0001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  21  2......EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR.............. 118
6 -63.8003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  26  1.....SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQR....... 125
7 -63.1002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model follow..  100  1.....SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR 132
8 -62.8002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  29  2GSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYN........... 127
9 -58.8002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  29  4GSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLRE........... 129
10 -57.2002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model follow..  26  2......SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEGYDR..................... 110
11 -57.1003rkv_A mol:protein length:162 putative peptidylprolyl isomerase  ali model follow..  21  3AEDDKLKSVEALRQKGNELFVQKDYKEAIDAYRDALELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVAREMKIVTERRAEKKADSRV... 154
12 -56.4003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  21  6...APTPESDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKRKIEEANRGAEPP. 138
13 -55.4002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model follow..  23  24TDEEKVQSAFDIKEEGNEFFKKNEINEAIVKYKEALKKKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARKKDKLTFGG 176
14 -55.1003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  19  1.....SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKEQ........... 128
15 -53.2001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  22  1.....GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGREIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPD.......................... 113
16 -50.7001p5q_A mol:protein length:336 FK506-binding protein 4  ali model follow..  23  133NSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYAN 284
17 -49.3003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  25  131EAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQ......... 258
18 -48.5001wao_1 mol:protein length:477 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  25  1...GALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDE 134
19 -47.5003kd7_A mol:protein length:125 CTPR390  ali model follow..  24  1GAMDPGNSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNLGNAKQKQ............. 124
20 -46.2002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  24  1........AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQK. 128
21 -45.9001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  25  1GAMDPGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQ............. 124
22 -44.8002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  25  1GAMDPGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAKQNLGNAKQKQ............. 124
23 -44.5002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  14  15..EISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHE. 148
24 -44.3002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  14  15..EISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHE. 148
25 -44.2002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  18  1...EKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGD. 132
26 -43.8002if4_A mol:protein length:338 ATFKBP42  ali model follow..  21  171TVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQKQKEMYKG 324
27 -43.7002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  16  12..GLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKDR.... 142
28 -42.6002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  15  3KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERMMEVAIDRIAQLGAS... 159
29 -42.5001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  14  9EANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQL........................ 121
30 -41.7001kt0_A mol:protein length:457 51 KDA FK506-BINDING PROTEIN  ali model follow..  21  260DTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYAN 411
31 -41.5001kt1_A mol:protein length:457 FK506-binding protein FKBP51  ali model follow..  22  262..KEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYAN 411
32 -41.2003asg_A mol:protein length:186 MamA  ali model follow..  13  34VYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKK. 169
33 -41.2003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  14  34VYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKK. 169
34 -41.1003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  19  1......ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEA..................... 110
35 -40.9002q7f_A mol:protein length:243 YrrB protein  ali model follow..  19  77ALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDK. 212
36 -40.9003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  21  17SPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSDFDGASIEPMLERNLNKQAMKVLNENLSKDEGR 156
37 -40.8003asd_A mol:protein length:200 MamA  ali model follow..  13  34VYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKK. 169
38 -40.1003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  15  26..AIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE......... 151
39 -39.7003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  14  30..AIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ............. 151
40 -39.6002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  18  12LYFQSMADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKE...................... 126
41 -39.2002kck_A mol:protein length:112 TPR repeat  ali model follow..  11  2....VDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDNKDVWAAKADALRYIEGKEVEAEIAEARAKLE.............................. 106
42 -39.1001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  15  39....DDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAKEVLKQH. 170
43 -38.8003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  11  66KVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANAAQDPDTKQGLAKP.. 200
44 -38.7001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  20  36..AVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKA................... 167
45 -38.5003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  13  1.....GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYTELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYK 148
46 -38.3001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  18  2....SLVEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN........................... 104
47 -37.5003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  20  171..DPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENI............. 292
48 -37.4001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  15  93ALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLR. 228
49 -37.3002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  14  1........................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSDQQVVKELQVFLRRLAREDALE...... 109
50 -37.0002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  13  2.....QTAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQ. 143
51 -37.0003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  13  185ALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIK 330
52 -36.4001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  20  211..DPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENI............. 332
53 -36.2003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  23  164ALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGEA.................... 280
54 -36.1003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  23  164ALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGE..................... 279
55 -35.7001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  26  1GAMDPGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG.............................................. 91
56 -35.3002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  16  2..EKANQVSNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKK. 172
57 -34.9001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  13  2........PLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLGG 151
58 -34.5002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  18  23TDKGRDEARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEK. 160
59 -34.4003k9i_A mol:protein length:117 BH0479 protein  ali model follow..  12  2....................VLGLEAQAVPYYEKAIASGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETI........................ 97
60 -34.3002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model follow..  16  36KIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINMAKLLQRRSD...... 169
61 -33.7001ihg_A mol:protein length:370 Cyclophilin 40  ali model follow..  23  215DVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAYAK 367
62 -33.5002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  13  70ALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQYYDL. 207
63 -33.2003ffl_A mol:protein length:167 Anaphase-promoting complex subunit 7  ali model follow..  18  49ELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQ---------KKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKLAECYTVLKQDKDAIAILDGIPSRQRT............................ 148
64 -32.8001iyg_A mol:protein length:133 Hypothetical protein (2010003O14)  ali model follow..  2.....SSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSEDIRRGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKS.......... 128
65 -32.5003v6t_A mol:protein length:499 dHax3  ali model follow..  10  330AHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDP. 465
66 -32.0001nzn_A mol:protein length:126 Fission protein Fis1p  ali model follow..  1........GSHMEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRNDDIRKGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK........... 123
67 -32.0002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  15  5.............KTIKELINQGDIENALQALEEFLQTEPVGDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMVMD-ILNFYNKDMYNQLE................................... 93
68 -31.6003v6p_A mol:protein length:442 dHax3  ali model follow..  12  323AHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTNDH.......................... 433
69 -31.3002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  16  365LVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHFQN. 500
70 -30.5001pc2_A mol:protein length:152 mitochondria fission protein  ali model follow..  1...........MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSDDIRKGIVLLEELLPKGSKQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.......... 121
71 -30.4002v5f_A mol:protein length:104 PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1  ali model follow..  15  4.......TAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS...................................... 102
72 -30.1001tjc_A mol:protein length:108 Prolyl 4-hydroxylase alpha-1 subunit  ali model follow..  15  4.......TAEDSFELGKVAYTEADYYHTELWMEQALRQLDDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS...................................... 102
73 -30.1002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model follow..  29  3........AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS............................................................. 70
74 -30.0003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model follow..  12  2...EDPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVAREEQKDLSELQDAKLKAEGLE........................................... 94
75 -29.3003ro3_A mol:protein length:164 G-protein-signaling modulator 2  ali model follow..  13  1GPGSRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIRIGEGRACWSLGNAYTALGNHDQAMHFAEK. 154

FFAS is supported by the NIH grant R01-GM087218-01
6 0 2 5 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.