current user: public




Query: 3q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GPHMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRLast
1 -84.0003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model  100  1GPHMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR 137
2 -83.1004kbq_A mol:protein length:139 E3 ubiquitin-protein ligase CHIP  ali model follow..  97  4.GSEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR 139
3 -70.9001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  26  6.ADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKD-----AKMKYQECNKIVKQKAFER. 135
4 -70.7002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  26  8.ADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQK.......... 133
5 -69.7004cgw_A mol:protein length:117 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  31  11.AQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP............................. 117
6 -69.5004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  28  6GIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKEN........ 134
7 -69.0003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  24  4.SMAPTPESDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGS---DAMKRGLETTKRKIEEANRGA. 135
8 -68.7002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  31  2GSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADG..................... 117
9 -68.7002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  32  4GSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDN-----ETYKSNLKIAELKLREA..... 130
10 -67.5004gco_A mol:protein length:126 Protein STI-1  ali model follow..  27  6.AYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREG..................... 120
11 -66.9002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model follow..  100  1.....SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR 132
12 -66.8003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  29  1.....SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNN......................... 107
13 -65.6001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  21  2......EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQ-----LKEGLQNMEAR......... 118
14 -64.7002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  30  21.ATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDADQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEA..................... 138
15 -61.4004cgu_A mol:protein length:112 TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH  ali model follow..  26  2.....MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEGYDRS.................... 112
16 -61.3001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  21  1.....GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPD.......................... 113
17 -60.6003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  21  1.....SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKV......................... 114
18 -55.0004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  20  1.SNAMTDAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGREIAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVK....................... 120
19 -54.0003rkv_A mol:protein length:162 putative peptidylprolyl isomerase  ali model follow..  21  3AEDDKLKSVEALRQKGNELFVQKDYKEAIDAYRDALELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAA----SVVAREMKIVTERRAEKKADSR 153
20 -53.5004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  24  33ITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDAS........................ 145
21 -53.1004ja7_A mol:protein length:488 Serine/threonine-protein phosphatase 5  ali model follow..  26  10.AEGTLKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPNDKDAKMK-YQECSKIVKQKAFER..... 139
22 -51.9001wao_1 mol:protein length:477 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  26  1...GALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMECNKIVKQKAFERAIAGDEHKR 137
23 -51.1002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model follow..  24  24TDEEKVQSAFDIKEEGNEFFKKNEINEAIVKYKEALKKKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLD-----IRNSYELCVNKLKEARKKDK 171
24 -50.9004apo_A mol:protein length:165 AH RECEPTOR-INTERACTING PROTEIN  ali model follow..  21  6TAEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALA----PVVSRELQALEARIRQKDEEDK 156
25 -50.6004i2w_A mol:protein length:961 Protein UNC-45  ali model follow..  23  2..VARVQTAEEIRDEGNAAVKDQDYIKADELYTEALQLTTDEPVLYRNRAMARLKRDDFEGAQSDCTKALEFDGADVKALFRRSLAREQLGNVGPAFQDAKEALRLSPNDKGIVEVLQRLVKANNDKIKQTTSLANK 141
26 -46.9003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  27  131EAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNG........................ 243
27 -45.5003kd7_A mol:protein length:125 CTPR390  ali model follow..  25  1GAMDPGNSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQN..................... 116
28 -45.3001p5q_A mol:protein length:336 FK506-binding protein 4  ali model follow..  22  133NSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKA-----AKTQLAVCQQRIRRQLAREK 279
29 -44.4002if4_A mol:protein length:338 ATFKBP42  ali model follow..  22  171TVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKA-----IRRELRALAEQEKALYQKQK 319
30 -43.6001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  27  1GAMDPGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQN..................... 116
31 -43.5002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  19  1...EKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKE-DPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKE..... 128
32 -42.1002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  29  27ALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS........................... 136
33 -42.1002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  26  1GAMDPGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAKQN..................... 116
34 -41.9001kt1_A mol:protein length:457 FK506-binding protein FKBP51  ali model follow..  24  260DTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQ-----IFMCQKKAKEHNERDR 406
35 -41.1001kt0_A mol:protein length:457 51 KDA FK506-BINDING PROTEIN  ali model follow..  24  260DTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSSESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQ-----ISMCQKKAKEHNERDR 406
36 -41.0003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  21  17SPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSK. 152
37 -40.5003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  19  1......ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEE........................ 107
38 -40.3002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  16  14....SEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKDR.... 142
39 -40.3003wxx_A mol:protein length:151 AcrH  ali model follow..  15  22....STDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSAQLLAAAKPELAELAARAGIMLEVVKTKKDME... 151
40 -39.8002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  14  17....SSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHE. 148
41 -39.5002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  14  17....SSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVSSMLEAIKLKKEMKHE. 148
42 -38.0002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  19  15...QSMADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEE........................ 124
43 -37.6004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  17  33WARHEKNDPEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKY........................ 145
44 -37.4004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  17  34.EPANPLNYALLTNLGTIQRRQGKLQEALISYTSALSGHTKNITILENRASLYTELGETEKALNDYNTLLIENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEKSVRA........................ 145
45 -36.9001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  18  3MGSMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQ.......................... 110
46 -36.9003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  15  32....PDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEK.......................... 138
47 -36.8004i17_A mol:protein length:228 hypothetical protein  ali model follow..  16  3....QTTDPNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNAT......................... 111
48 -36.7001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  14  9EANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQ......................... 120
49 -36.6004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  17  56....SSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPL......................... 163
50 -36.6003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  15  28....PDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEK.......................... 134
51 -36.1003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  15  68SIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVE........................ 180
52 -36.0003asd_A mol:protein length:200 MamA  ali model follow..  14  68SLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELA...................... 182
53 -35.9003vtx_A mol:protein length:184 MamA  ali model follow..  15  31VLKADPNNVETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRA........................ 143
54 -35.7001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  18  2....SLVEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQ.......................... 105
55 -35.6001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  17  39....DDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPND........................... 144
56 -35.5002q7f_A mol:protein length:243 YrrB protein  ali model follow..  19  43AIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEA........................ 155
57 -35.4003asg_A mol:protein length:186 MamA  ali model follow..  15  68SLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVE........................ 180
58 -35.1001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  26  1GAMDPGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG.............................................. 91
59 -34.9003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  15  1.....GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYTELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAA........................ 124
60 -34.1002kck_A mol:protein length:112 TPR repeat  ali model follow..  14  2....VDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDEKDVWAAKADALRYIGKEVEAEIAEARAK................................. 104
61 -33.8003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  20  171..DPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGP........................ 281
62 -33.8002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  18  5..LKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRWISAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGE........................ 138
63 -33.6002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  14  1........................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQ........................ 89
64 -33.4003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  13  66KVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNI........................... 175
65 -33.1003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  23  164ALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTP........................ 276
66 -32.8002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  16  2.....QTAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPL........................ 120
67 -32.7003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  23  164ALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTP........................ 276
68 -32.7001ihg_A mol:protein length:370 Cyclophilin 40  ali model follow..  25  221......LISEDLKNIGNTFFKSQNWEMAIKKYTKVLKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDK-----AIQAELLKVKQKIKAQKDKEK 362
69 -32.6001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  20  211..DPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGP........................ 321
70 -32.4001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  20  263AIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADA........................ 375
71 -32.0004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  18  207..NGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQ........................ 317
72 -31.7004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  17  4...............GSMRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKD......................... 100
73 -31.4002kc7_A mol:protein length:99 bfr218_protein  ali model follow..  15  5.............KTIKELINQGDIENALQALEEFLQTEPVGDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKM-VMDILNFYNKDMYNQLE................................... 93
74 -31.4005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  16  716AANLFPMSHNVLYMRGQIAELRGSMDEARRWYEEALAISPTHVKSMQRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATECFLTALELEASS........................... 825
75 -31.4004ga2_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  17  2.............PLGSMRRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKD......................... 100

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.