current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: 3pqj_A mol:protein length:102 Biofilm growth-associated repressor, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
5 -59.5003cuo_A mol:protein length:99 Uncharacterized HTH-type transcriptional regu  ali model follow..  27  2TELAQLQASAEQAAALLKAMSHPKRLLILCMLSGSPTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYCP..... 99
6 -46.5002zkz_A mol:protein length:99 Transcriptional repressor pagR  ali model follow..  26  5VDHKIEYMSLEDDAELLKTMAHPMRLKIVNELYKKALNVTQIIQILKLPQSTVSQHLCKMR-GKVLKRNRQGLEIYYSINNPKVEGIIKLLNPI........ 98
8 -34.3004rs8_A mol:protein length:84 AspA  ali model follow..  22  2..................IFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQMATAELEKI........ 77
9 -34.2002lkp_A mol:protein length:119 Transcriptional regulator, ArsR family  ali model follow..  37  16......SQAAAQVASTLQALATPSRLMILTQLRNGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGRSIVYSLYDTHVAQLLD............. 98
10 -34.0004rsb_C mol:protein length:92 AspA  ali model follow..  20  1..........GKISTDKYIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQLATAELEKI........ 84
11 -33.6001r1u_A mol:protein length:106 repressor protein  ali model follow..  24  10......TDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLK............. 92
12 -33.4004ggg_A mol:protein length:105 Repressor protein  ali model follow..  24  9......TDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSAHVVKAKRQGQSMIYSLDDIHVATMLK............. 91
13 -32.2002jsc_A mol:protein length:118 Transcriptional regulator Rv1994c/MT2050  ali model follow..  25  5......EMRESALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEGRQVRYALADSHLARALGELVQVVLAVDTD. 99
14 -31.8001r22_A mol:protein length:122 Transcriptional repressor smtB  ali model follow..  31  30......PEVAQSLAEFFAVLADPNRLRLLSLLARSELSVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQ............. 112
15 -31.8001r1t_A mol:protein length:122 Transcriptional repressor smtB  ali model follow..  30  30......PEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQ............. 112
16 -29.6002vxz_A mol:protein length:165 PYRSV_GP04  ali model follow..  16  9....................VLVRLRDILALLADGCKTTSLIQQRLGLSHGRAKALIYVLEKEGRVTRVAFGNVALVCLSMDQYRQLVDGMIR......... 81
17 -29.1001u2w_A mol:protein length:122 Cadmium efflux system accessory protein  ali model follow..  21  26......TVDISGVSQILKAIADENRAKITYALCDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALYSLGDEHIRQIMMI............ 110
18 -29.1003f72_A mol:protein length:122 Cadmium efflux system accessory protein  ali model follow..  21  26......TVDISGVSQILKAIADENRAKITYALCDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALYSLGGEAIRQIMMI............ 110
19 -25.6003f6v_A mol:protein length:151 Possible transcriptional regulator, ArsR fami  ali model follow..  28  35.....VTTNVLVVLDQLEVAAEPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDGRFRYYRLDPQGLAQLRALFDSFW....... 124
20 -25.3002oqg_A mol:protein length:114 Possible transcriptional regulator, ArsR fami  ali model follow..  20  4.....TVGTYAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVGREIRYRALGAELNKTARTL........... 89
21 -22.4002p4w_A mol:protein length:202 Transcriptional regulatory protein arsR famil  ali model follow..  24  2.........GEELNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEGRPRKYYMIKKGLRLEILLTPTLF....... 91
22 -21.4001y0u_A mol:protein length:96 arsenical resistance operon repressor, putati  ali model follow..  18  9IKADSLEKADEYHKRYNYAVTNPVRRKILRMLDKGR-SEEEIMQTLSLSKKQLDYHLKVLEAGFCIE--RVGERWVVTDAGKIVDKIRG............. 94
23 -21.4003f6o_A mol:protein length:118 Probable transcriptional regulator, ArsR fami  ali model follow..  17  1.....MAQYPEQLNGIFQALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQGRVRTCAIEKEPFTAVEAWL........... 86
24 -20.5005duk_A mol:protein length:77 putative DNA binding protein  ali model follow..  14  3................ADALELDTRREIYKHIVKSPLHERQLAKELDVPLSTLVYHLHYLERRELIMMKSDERYARYYATKKLGARAKEV............ 77
25 -20.2002qlz_A mol:protein length:232 Transcription Factor PF0095  ali model follow..  17  3.............PDLFYILGNKVRRDLLSHLTCMECYFSLLSSKVSVSSTAVAKHLKIMEREGVLQSYEKEER-YYKISIAKSYVF............... 82
26 -17.3001uly_A mol:protein length:192 hypothetical protein PH1932  ali model follow..  21  9...........TDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMK-YYGRTAD.................... 84
27 -15.9003u1d_A mol:protein length:151 uncharacterized protein  ali model follow..  22  14.......NGFGDELERRRFVLHETRLDVLHQILDGVLSVEELLYRNDETEANLRYHVDELVDRGIVEKIDDPPTTFYAVTG..................... 99
28 -14.8003m8e_A mol:protein length:124 Putative DNA-binding protein  ali model follow..  11  34................NDDCAYQVLMAFINENGEAQLNKTAVAEMIQLSKPTVFATVNSFYCAGYIDETRVGRSKIYTLSDLGVEIVECFKQKA........ 112
29 -14.3004g6q_A mol:protein length:182 Putative uncharacterized protein  ali model follow..  20  2.NAMETTGQMPATSSLVDLLHHPLRWRITQLLIGRSLTTRELAELLPVATTTLYRQVGILVKAGVLMVVRGAVERTYTLNTQAG.................. 90
30 -13.6003ke2_A mol:protein length:117 uncharacterized protein YP_928783.1  ali model follow..  18  2.....MTQDNASGDQVSKQHKAFLRKLYLAHLMDARHNLLSLGKLTGMPRRTLQDAIASFADIGIVEFVQDGER-YYRIRT..................... 82
31 -13.4002qvo_A mol:protein length:95 Uncharacterized protein AF_1382  ali model follow..  12  28.................................GNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDK.................... 76
32 -13.4001ub9_A mol:protein length:100 Hypothetical protein PH1061  ali model follow..  22  11.................HILGNPVRLGIMIFLLPRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYK................................ 64
33 -13.0002fsw_A mol:protein length:107 PG_0823 protein  ali model follow..  19  15............VRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAIGISEKMLIDELKFLCGKGLIKKKQYPERVEYSLTPEKVLPIIDEIAK......... 101
34 -12.8001z7u_A mol:protein length:112 hypothetical protein EF0647  ali model follow..  24  12............INLALSTINGKWKLSLMDELFQGTKRNGELMRALGITQRVLTDRLREMEKDGLVHRESFNERVEYTLTPYALYDALSSLCH......... 98
35 -12.6002hzt_A mol:protein length:107 Putative HTH-type transcriptional regulator y  ali model follow..  23  4............VEATLEVIGGKWKCVILCHLTHGKKRTSELKRLMNITQKMLTQQLRELEADGVINRIVYNQKVEYELSERSLEGILDMLCA......... 90
36 -12.6004hw0_A mol:protein length:104 DNA-binding protein Sso10a-2  ali model follow..  12  6....................RKRGTMEIMFDILRPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDRKIYEITEK.................... 70
37 -12.5003cta_A mol:protein length:230 Riboflavin kinase  ali model follow..  18  25.................................RAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEKGLDVL............... 78
38 -12.4003df8_A mol:protein length:111 possible HxlR family transcriptional factor  ali model follow..  28  17............SESVLHLLGKKYTMLIISVLGNGRQNFNDIRSSIGISSTILSRRIKDLIDSGLVE-RRSGQITTYALTE..................... 87
39 -12.4002rvc_A mol:protein length:64 Interferon-inducible and double-stranded-depe  ali model follow..  15  1................MSAETQMERKIIDFLRQNGKSIALTIAKEIGLDKSTVNRHLYNLQRSNQVFNSNEKPPVW.......................... 60
41 -11.9003l09_A mol:protein length:266 Putative transcriptional regulator  ali model follow..  21  2.....VADASDPIRPLVEALNAEAPLKLWSVLVTGDVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPA 111
42 -11.9002f2e_A mol:protein length:146 PA1607  ali model follow..  23  2VKRTSHKQASCPVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVESGSHQEYRLTDK.................... 85
43 -11.7002d1h_A mol:protein length:109 109aa long hypothetical transcriptional regul  ali model follow..  16  2.....MKEKLESKKDEIRCCDTDVAVLLKMVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTEGKYYYSISSNILEKIRNDLLNCA....... 101
44 -11.6004gcv_A mol:protein length:168 Putative transcription protein  ali model follow..  17  1MQRKTFADAECPIARSLERVGEWWSILIMRDALQGLRRFDEFSRSLDIAPNMLTRRLNALVEAGLLERQSQRPLRYQYVPTAKGEDFRVVLMAF........ 96
45 -11.4004asn_A mol:protein length:101 TUBR  ali model follow..  12  13.....................TIEDVSILGWLFQNAIKKSSIADELEYSTANFRKTLNKLEAIHFIGTVTGGKEHKLYLTEYGQQAVQQAI........... 89
46 -11.4001yyv_A mol:protein length:131 putative transcriptional regulator  ali model follow..  20  25............SREVLKHVTSRWGVLILVALRDGTHRFSDLRRKMGVSEKMLAQSLQALEQDGFLNRVSYPVHVEYSLTP..................... 97
47 -11.3002frh_A mol:protein length:127 Staphylococcal accessory regulator A  ali model follow..  12  43.........................LTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRDERTVLILVNAQQRKKIESLL........... 111
48 -11.1002mh2_A mol:protein length:84 Homologous-pairing protein 2 homolog  ali model follow..  19  1MSKSRAEAAAGAPGIILRYLQEQNRPYSAQDVFG------NLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKIYFADQNQFDTVSDA............ 84
49 -11.0004lb5_A mol:protein length:72 Protein kinase containing Z-DNA binding domai  ali model follow..  12  5...............ASSAENEIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDN............................. 62
50 -10.9002wte_A mol:protein length:244 CSA3  ali model follow..  15  145.....................SREEMKLLNVLYEKGTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVELNELGLNVIKLNKSVIE......... 217
51 -10.7002lnb_A mol:protein length:80 Z-DNA-binding protein 1  ali model follow..  14  2.........GSHMADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPAT---WCLGGT.................... 71
52 -10.6003tgn_A mol:protein length:146 Adc operon repressor AdcR  ali model follow..  22  37.....................TNTQEHILMLLSEESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDARVIFYQLTDL.................... 100
53 -10.6004rbr_A mol:protein length:139 HTH-type transcriptional regulator rot  ali model follow..  14  35...................MSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERDERTVIIHFNEK.................... 100
54 -10.6004q77_A mol:protein length:139 HTH-type transcriptional regulator rot  ali model follow..  14  35...................MSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERDERTVIIHFNEK.................... 100
55 -10.5002eb7_A mol:protein length:146 146aa long hypothetical transcriptional regul  ali model follow..  18  36.....................SYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDRRKILIEITEK.................... 99
56 -10.5002o0y_A mol:protein length:260 Transcriptional regulator  ali model follow..  11  10.......EKPAVADAGVRSVTRVIDLLELFDAAHPTRSLKELVEGTKLPKTTVVRLVATMCARSVLTSRADGS---YSLG...................... 79
57 -10.3001sfu_A mol:protein length:75 34L protein  ali model follow..  14  27.................................NDYTTAISLSNRLKINKKKINQQLYKLQKEDTVK-MVPSNPPKWFKNYN.................... 74
58 -10.3001p4x_A mol:protein length:250 staphylococcal accessory regulator A homologu  ali model follow..  15  164.........................LAIITSQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERDERKILIHMDDAQQDHAEQLLAQV........ 235
59 -10.2003r0a_A mol:protein length:123 Putative transcriptional regulator  ali model follow..  11  32.........................MKSFLNEPDRWIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQDGGGYVYIYKIYSKNQIRNIIQK......... 102
60 -10.1001oyi_A mol:protein length:82 double-stranded RNA-binding protein  ali model follow..  14  20.........................CEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVY-SSDDIPPRWFMTTEA................... 76
61 -9.8301tbx_A mol:protein length:99 Hypothetical 11.0 kDa protein  ali model follow..  17  6...................FFYPEAIVLAYLYDNEGIATYDLYKKVNMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEK.................... 72
63 -9.7401q1h_A mol:protein length:110 Transcription Factor E  ali model follow..  16  1.....MVNAEDLFINLAKSLLGDDVIDVLRILLDKGTEMTDIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRDKYYWKPNIDQINEIL.............. 91
64 -9.6501j75_A mol:protein length:67 Tumor Stroma and Activated Macrophage Protein  ali model follow..  17  12......................EQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPAT---WSIGG..................... 67
65 -9.6104hob_A mol:protein length:69 Putative uncharacterized protein  ali model follow..  15  7.................NPISEEMNLKILAYLGTQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVR-KHPQHPVWYLPA...................... 69
66 -9.6002rdp_A mol:protein length:150 putative transcriptional regulator MarR  ali model follow..  25  40...................ITPPQFVALQWLLEEGDLTVGELSNKMYLACSTTTDLVDRMERNGLVARVRDRRVVRIRLLEK.................... 105
68 -9.5503f3x_A mol:protein length:144 Transcriptional regulator, marR family, putat  ali model follow..  15  39........................DFSILKATSEEPRSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDRRIVIVEITPK.................... 99
69 -9.5405aip_A mol:protein length:146 TRANSCRIPTIONAL REGULATOR, MARR FAMILY  ali model follow..  20  34...................ITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLKDQRRVFLKLTAE.................... 99
70 -9.5002htj_A mol:protein length:81 P fimbrial regulatory protein KS71A  ali model follow..  12  2........................KNEILEFLNRNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRR............................. 51
71 -9.4905jbr_A mol:protein length:149 Uncharacterized protein Bcav_2135  ali model follow..  16  28.......................GRTYGYLLLQSEATSFQEIGADLGLSPGAVSTSVRELVAWGLARSRRL----LVEAAGG.................... 88
72 -9.4602fxa_A mol:protein length:207 Protease production regulatory protein hpr  ali model follow..  17  46...................LNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKDKRNTYVQLTEE.................... 111
73 -9.4403r4k_A mol:protein length:260 Transcriptional regulator, IclR family  ali model follow..  24  2................MGTVSKALTLLTYFNHGRLEIGLSDLTRLSGMNKATVYRLMSELQEAGFVEQVEGARS--YRLG...................... 63
74 -9.3604hqe_A mol:protein length:115 Transcriptional regulator QsrR  ali model follow..  20  8.........CPYLEETFKILGRSWNGLIINYLSDCSAHFSDMKRDLTITPRALSLKLSELAQWELVEKQIISTQIIYVLTEKALAEALHPIEA......... 100
75 -9.3604hqm_A mol:protein length:115 QsrR protein  ali model follow..  20  8.........CPYLEETFKILGRSWNGLIINYLSDSSAHFSDMKRDLTITPRALSLKLSELAQWELVEKQIISTQIIYVLTEKALAEALHPIEA......... 100

FFAS is supported by the NIH grant R01-GM087218-01
1 0 8 9 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.