current user: public

Query: 3pqj_A mol:protein length:102 Biofilm growth-associated repressor, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
4 -51.8003cuo_A mol:protein length:99 Uncharacterized HTH-type transcriptional regu  ali model follow..  28  3.ELAQLQASAEQAAALLKAMSHPKRLLILCMLSGSPTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYCP..... 99
6 -47.4001r22_A mol:protein length:122 Transcriptional repressor smtB  ali model follow..  26  26..QAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELSVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQESR... 122
7 -47.2001r1t_A mol:protein length:122 Transcriptional repressor smtB  ali model follow..  25  26..QAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQECR... 122
8 -47.1003f72_A mol:protein length:122 Cadmium efflux system accessory protein  ali model follow..  18  26......TVDISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALYSLGGEAIRQIMMIALAHKKEVKVN. 121
9 -47.0001u2w_A mol:protein length:122 Cadmium efflux system accessory protein  ali model follow..  18  26......TVDISGVSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALYSLGDEHIRQIMMIALAHKKEVKVN. 121
10 -46.4002jsc_A mol:protein length:118 Transcriptional regulator Rv1994c/MT2050  ali model follow..  24  1..MLTCEMRESALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEGRQVRYALADSHLARALGELVQVVLAVDTD. 99
11 -45.6002zkz_A mol:protein length:99 Transcriptional repressor pagR  ali model follow..  26  5VDHKIEYMSLEDDAELLKTMAHPMRLKIVNELYKKALNVTQIIQILKLPQSTVSQHLCKMR-GKVLKRNRQGLEIYYSINNPKVEGIIKLLNPI........ 98
12 -38.8003f6v_A mol:protein length:151 Possible transcriptional regulator, ArsR fami  ali model follow..  26  30LHNALVTTNVLVVLDQLEVAAEPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDGRFRYYRLDPQGLAQLRALFDSFWIDE.... 127
13 -37.1002vxz_A mol:protein length:165 PYRSV_GP04  ali model follow..  14  1............MPIGHSREVLVRLRDILALLADGCKTTSLIQQRLGLSHGRAKALIYVLEKEGRVTRVAFGNVALVCLSMDQYRQLVDGMIREV....... 83
14 -36.4002oqg_A mol:protein length:114 Possible transcriptional regulator, ArsR fami  ali model follow..  21  4.....TVGTYAELASVFAALSDETRWEILTELGRADQSASSLATRLPVSRQAIAKHLNALQACGLVESVKVGREIRYRALGAELNKTARTLERI........ 92
15 -35.2001y0u_A mol:protein length:96 arsenical resistance operon repressor, putati  ali model follow..  18  9IKADSLEKADEYHKRYNYAVTNPVRRKILRML-DKGRSEEEIMQTLSLSKKQLDYHLKVLEAGFCIE-RVGERWVVTDAGK..................... 87
17 -32.7002p4w_A mol:protein length:202 Transcriptional regulatory protein arsR famil  ali model follow..  23  2.........GEELNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEGRPRKYYMIKKGLRLEILLTPTLFGSE.... 94
18 -32.1003f6o_A mol:protein length:118 Probable transcriptional regulator, ArsR fami  ali model follow..  17  1.....MAQYPEQLNGIFQALADPTRRAVLGRLSRGPATVSELAKPFDMALPSFMKHIHFLEDSGWIRTHKQGRVRTCAIEKEPFTAV............... 82
19 -30.3002qlz_A mol:protein length:232 Transcription Factor PF0095  ali model follow..  17  3.............PDLFYILGNKVRRDLLSHLTCMECYFSLLSSKVSVSSTAVAKHLKIMEREGVLQSYEKEEKKYYKISIAKSYVFT.............. 83
20 -24.2001ub9_A mol:protein length:100 Hypothetical protein PH1061  ali model follow..  17  7.............IMKSHILGNPVRLGIMIFLLPRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKDRPRTVVEITDFGMEEAKRFLSSL........ 91
21 -20.8003u1d_A mol:protein length:151 uncharacterized protein  ali model follow..  22  13......PNGFGDELERRRFVLHETRLDVLHQILAGVLSVEELLYRNDETEANLRYHVDELVDRGIVESVDDPPTTFYAVTG..................... 99
22 -15.4002qvo_A mol:protein length:95 Uncharacterized protein AF_1382  ali model follow..  11  28.................................GNDVYIQYIASKVNSPHSYVWLIIKKFEEAKMVECELEGRTKIIRLTDK--QKIAQQIKSIIDIMENDT 95
23 -14.9002f2e_A mol:protein length:146 PA1607  ali model follow..  23  2VKRTSHKQASCPVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVPAESGSHQEYRLTD..................... 84
24 -14.2001oyi_A mol:protein length:82 double-stranded RNA-binding protein  ali model follow..  14  20.........................CEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVY-SSDDIPPRWFMTTE.................... 75
25 -14.0001j75_A mol:protein length:67 Tumor Stroma and Activated Macrophage Protein  ali model follow..  13  1.............GSHMLSTGDNLEQKILQVLSDDGVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPAT---WSIG...................... 66
26 -13.4002wte_A mol:protein length:244 CSA3  ali model follow..  15  145.....................SREEMKLLNVLYETKTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVELNELGLNVIKLNKSVIE......... 217
27 -13.1003df8_A mol:protein length:111 possible HxlR family transcriptional factor  ali model follow..  28  17............SESVLHLLGKKYTMLIISVLGNGRQNFNDIRSSIGISSTILSRRIKDLIDSGLVE-RRSGQITTYALTE..................... 87
28 -13.0002lnb_A mol:protein length:80 Z-DNA-binding protein 1  ali model follow..  13  12.....................GHLEQRILQVLTESPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPA---TWCLGGT.................... 71
29 -12.9001sfu_A mol:protein length:75 34L protein  ali model follow..  14  14.....................FSLVKKEVLSLNTDYTTAISLSNRLKINKKKINQQLYKLQKEDTVK-MVPSNPPKWFKNYN.................... 74
30 -12.8002fsw_A mol:protein length:107 PG_0823 protein  ali model follow..  21  15............VRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAIGISEKMLIDELKFLCGKGLIKKKQYPERVEYSLTP..................... 87
31 -12.7003cta_A mol:protein length:230 Riboflavin kinase  ali model follow..  15  14.......................KKIKEAAEASNAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITEK.................... 73
32 -12.7001z7u_A mol:protein length:112 hypothetical protein EF0647  ali model follow..  27  12............INLALSTINGKWKLSLMDELFQGTKRNGELMRALGITQRVLTDRLREMEKDGLVHRESFNERVEYTLTP..................... 84
33 -12.4002hzt_A mol:protein length:107 Putative HTH-type transcriptional regulator y  ali model follow..  26  4............VEATLEVIGGKWKCVILCHLTHGKKRTSELKRLMNITQKMLTQQLRELEADGVINRIQVPPKVEYELSE..................... 76
34 -12.4003b73_A mol:protein length:111 PhiH1 repressor-like protein  ali model follow..  25  12.....................TIWDDRILEIIHEGNGSPKELEDRIRISKSSVSRRLKKLADHDLLQPLANG---VYVITEEGEAYL............... 77
36 -12.2001ku9_A mol:protein length:152 hypothetical protein MJ223  ali model follow..  15  30........................AVYAILYLSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIERKNYYEAVDG.................... 89
37 -12.1001yyv_A mol:protein length:131 putative transcriptional regulator  ali model follow..  20  25............SREVLKHVTSRWGVLILVALRDGTHRFSDLRRKMGVSEKMLAQSLQALEQDGFLNRVSYPVHVEYSLTP..................... 97
38 -12.0002d1h_A mol:protein length:109 109aa long hypothetical transcriptional regul  ali model follow..  16  20.....................TDTDVAVLLKMVEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKIGRPKYYYSISSNILEKI.............. 93
39 -12.0001sfx_A mol:protein length:109 Conserved hypothetical protein AF2008  ali model follow..  25  2.....MSNPLGELVKALEKLSKPSDVRIYSLLLEGGMRVSEIARELDLSARFVRDRLKVLLKRGFVR................................... 65
40 -11.9002heo_A mol:protein length:67 Z-DNA binding protein 1  ali model follow..  13  8....................GDNLEQKILQVLSDDGVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSPSPKY---WSIG...................... 66
41 -11.9002htj_A mol:protein length:81 P fimbrial regulatory protein KS71A  ali model follow..  12  2........................KNEILEFLNRNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRR............................. 51
42 -11.8002frh_A mol:protein length:127 Staphylococcal accessory regulator A  ali model follow..  12  43.........................LTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRDERTVLILVNAQ.................... 102
43 -11.7003tgn_A mol:protein length:146 Adc operon repressor AdcR  ali model follow..  22  37.....................TNTQEHILMLLSEESLTNSELARRLNVSQAAVTKAIKSLVKEGMLETSKDARVIFYQLTDL.................... 100
44 -11.6003r0a_A mol:protein length:123 Putative transcriptional regulator  ali model follow..  12  32.........................MKSFLNEPDRWIDTDALSKSLKLDVSTVQRSVKKLHEKEILQRSQDGGGYVYIYKIYSKNQIRNIIQKIV....... 104
45 -11.5001k78_A mol:protein length:149 Paired Box Protein Pax5  ali model follow..  16  31.................RPLPDVVRQRIVELAHQG-VRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQ......... 105
46 -11.5002eb7_A mol:protein length:146 146aa long hypothetical transcriptional regul  ali model follow..  18  39........................DFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDRRKILIEITEK.................... 99
47 -11.4001r7j_A mol:protein length:95 Conserved hypothetical protein Sso10a  ali model follow..  5.......................SKLEIIQAILESGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQYML........................... 59
48 -11.4003f3x_A mol:protein length:144 Transcriptional regulator, marR family, putat  ali model follow..  15  38.......................LDFSILKATSEEPRSMVYLANRYFVTQSAITAAVDKLEAKGLVRRIRDRRIVIVEITPK.................... 99
49 -11.4002l54_A mol:protein length:63 Double-stranded RNA-specific adenosine deamin  ali model follow..  16  9.........................LKFLEELGEGKTTAHDLSGKLGTPKKEIARVLASLAKKGKLQ-KEAGTPPLWKIA...................... 63
50 -11.2006pax_A mol:protein length:133 HOMEOBOX PROTEIN PAX-6  ali model follow..  13  16.................RPLPDSTRQRIVELAHSG-ARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPRVATPEVVSKIAQYKQEC........ 91
51 -11.2003kp2_A mol:protein length:151 Transcriptional regulator TcaR  ali model follow..  13  38......................AEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKDQRLKIIKLSNK.................... 102
52 -11.2001pdn_C mol:protein length:128 PROTEIN (PRD PAIRED)  ali model follow..  14  16.................RPLPNNIRLKIVEMAADG-IRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIGGSKPRIATPEIENRIEEYKRS......... 90
53 -11.1001q1h_A mol:protein length:110 Transcription Factor E  ali model follow..  17  8............FINLAKSLLGDDVIDVLRILLDKGTEMTDIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRDKYYWKPNIDQINEIL.............. 91
54 -10.9002k27_A mol:protein length:159 Paired box protein Pax-8  ali model follow..  16  24.................RPLPEVVRQRIVDLAHQG-VRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQ......... 98
55 -10.8003l09_A mol:protein length:266 Putative transcriptional regulator  ali model follow..  20  2.....VADASDPIRPLVEALNAEAPLKLWSVLVT---ALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPA 111
56 -10.7003lmm_A mol:protein length:583 Uncharacterized protein  ali model follow..  19  515.....................AELTNAAMLWLSEGDLATSDLMAMCGVSRGTAKACVDGLVDEERVVAVGGGRSRRYRLVELE................... 577
57 -10.7002hr3_A mol:protein length:147 Probable transcriptional regulator  ali model follow..  15  37........................QLVVLGAILGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADGRRTRVSLSSE.................... 99
58 -10.6003ke2_A mol:protein length:117 uncharacterized protein YP_928783.1  ali model follow..  19  22........................KLYLAHLMDDARHNLLSLGKLTGMPRRTLQDAIASFADIGIVQDGERHNAGYYRIRT..................... 82
59 -10.5002hoe_A mol:protein length:380 N-acetylglucosamine kinase  ali model follow..  17  9.................KSVRAENISRILKRIMKSPVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEKDSPK............................ 65
60 -10.5002dbb_A mol:protein length:151 Putative HTH-type transcriptional regulator P  ali model follow..  19  8.....................DRVDMQLVKILSNSRLTYRELADILNTTRQRIARRIDKLKKLGIIR................................... 54
61 -10.4002xdi_A mol:protein length:107 TRP OPERON REPRESSOR  ali model follow..  24  22VDLLKNAYQNDLHLPLLNLMLTPTRVRIVEELLRGEMSQRELKNEFGAGIATITRGSNSLKA........................................ 90
62 -10.4001p4x_A mol:protein length:250 staphylococcal accessory regulator A homologu  ali model follow..  16  164.........................LAIITSQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERDERKILIHMDDAQQDHAEQLL........... 232
63 -10.3002obp_A mol:protein length:96 Putative DNA-binding protein  ali model follow..  13  34.................................ATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVE............................... 71
64 -10.3003kfw_X mol:protein length:247 Uncharacterized protein  ali model follow..  19  1...................MSLTARSVVLSVLLGAH-ELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLAR.................... 69
65 -10.3003irq_D mol:protein length:67 Double-stranded RNA-specific adenosine deamin  ali model follow..  17  9.........................LKFLEELGEGKTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWK......................... 61
66 -10.2002e7w_A mol:protein length:150 150aa long hypothetical transcriptional regul  ali model follow..  23  2.....................DEIDLRILKILQNAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIK................................... 48
67 -10.1001xd7_A mol:protein length:145 ywnA  ali model follow..  15...........................LSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAPGASLKKDPADISLLEVYRAV........... 80
68 -10.1001tro_A mol:protein length:108 PROTEIN (TRP REPRESSOR)  ali model follow..  24  23VDLLKNAYQNDLHLPLLNLMLTPTRVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKA........................................ 91
69 -10.1002cfx_A mol:protein length:144 HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC  ali model follow..  21  4.....................DQIDLNIIEELKDSRLSMRELGRKIKLSPPSVTERVRQLESFGIIK................................... 50
70 -9.9902o0y_A mol:protein length:260 Transcriptional regulator  ali model follow..  12  7....DSAEKPAVADAGVRSVTRVIDLLELFDAAHPTRSLKELVEGTKLPKTTVVRLVATMCARSVLTSRADGS---YSLG...................... 79
71 -9.9801jhg_A mol:protein length:101 TRP OPERON REPRESSOR  ali model follow..  22  16VDLLKNAYQNDLHLPLLNLMLTPTRVRIIEELLRGEMSQRELKNELGAGIATITRGSNSLKA........................................ 84
72 -9.9701tbx_A mol:protein length:99 Hypothetical 11.0 kDa protein  ali model follow..  17  6...................FFYPEAIVLAYLYDNEGIATYDLYKKVNMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEK.................... 72
73 -9.9702k4b_A mol:protein length:99 Transcriptional regulator  ali model follow..  24  28.....................SNAELIVMRVISLGEARVDEIYAQIEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYR........................ 89
74 -9.9601qbj_A mol:protein length:81 PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSI  ali model follow..  10  4.MLSIYQDQEQRILKFLEELGEGKATTAH-----------DLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWK......................... 68
75 -9.9402fxa_A mol:protein length:207 Protease production regulatory protein hpr  ali model follow..  17  46...................LNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKDKRNTYVQLTEE.................... 111

FFAS is supported by the NIH grant R01-GM087218-01
7 6 4 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46.