current user: public




Query: 3pfy_A mol:protein length:185 OTU domain-containing protein 5, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MSSGRENLYFQGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKALast
1 -102.0003pfy_A mol:protein length:185 OTU domain-containing protein 5  ali model  100  1MSSGRENLYFQGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKA 179
2 -88.2003tmo_A mol:protein length:184 OTU domain-containing protein 5  ali model follow..  95  2........SHMGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKA 177
3 -79.7004bop_A mol:protein length:151 OTU DOMAIN-CONTAINING PROTEIN 1  ali model follow..  22  1..............................DEKLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRSTMIHYLGPEDSLRPSIWLSWLSNGHYDAVFD.... 151
4 -77.5004bou_A mol:protein length:160 OTU DOMAIN-CONTAINING PROTEIN 3  ali model follow..  23  1.....................................GPEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDFEKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQI-RGTEKSSVRELHIAYRYGEHYDSVRRINDN 143
5 -66.6004hxd_B mol:protein length:174 RNA-directed RNA polymerase L  ali model follow..  11  2..........................FLDSLIWERVVDEQYITNPTFCVSDYFEVIRQPGDGNCFYHSIAELFFDVKTPSRKVKEHLQLAAEVYYDTEPEAVGISKDEYIKVAMKDNEWGGSLEASMLSKHLQTTIILWVVNSTEQVTAAIKPGRVSTALNLMHVGRTHFDALRIIEQL 160
6 -66.1003prm_A mol:protein length:178 L protein  ali model follow..  10  2.........................DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTSYHYIKRLTESAARKYYQEEPEARGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIKDGDVFTAVNLLHSGQTHFDALRILPQF 161
7 -63.9003phu_A mol:protein length:219 RNA-directed RNA polymerase L  ali model follow..  11  5..........................FLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHHYIKRLTESAARKYYQEEPEARGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAKFGDGDVFTAVNLLHSGQTHFDALRILPQF 163
8 -57.8004boq_A mol:protein length:183 UBIQUITIN THIOESTERASE OTU1  ali model follow..  18  18....................................................LTRTVVPADNSCLFTSVYYVVEGNPACAPEMRRLIAQIVASDPDFYSEAIGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRF-GEDAGYTKRVLLIYD-GIHYDPLQRNFPD 146
9 -57.7004bos_A mol:protein length:169 UBIQUITIN THIOESTERASE OTU1  ali model follow..  18  4....................................................LTRTVVPADNSALFTSVYYVVEGNPACAPEMRRLIAQIVASDPDFYSEAIGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRF-GEDAGYTKRVLLIYD-GIHYDPLQRNFPD 132
10 -54.3003by4_A mol:protein length:212 Ubiquitin thioesterase OTU1  ali model follow..  16  2..................................KRVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQDS-VRDLREMVSKEVLNNPVKFNDAIDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKIEKFN--EDKFDNYILILFN-GIHYDSLTMNEFK 143
11 -47.0003zrh_A mol:protein length:454 UBIQUITIN THIOESTERASE ZRANB1  ali model follow..  17  149............PTVQEKLFDEVLDRDVQKELEEESPIINWSLELATRLDSRLYALWNRTAGDCLLDSVLQATWGIYDKDSVLRKALHDSLHDCSHWFYTRWQEDWAFILSLASQPGASLEQTHIFVLAHILRRPIIVYGFQGVYLPLLWEQSFCWKSPIALGYTRG-HFSALVAMEND 352
12 -36.4004fjv_A mol:protein length:237 Ubiquitin thioesterase OTUB2  ali model follow..  15  1............GSHMSETSFNLISEKCDILSILRDHPENRIYRRKILSKRFTAIRKTKGDGNCFYRALGESLLGKSREIFKLRLLTSAFIRNRADFFRHFIDEEIKDFCHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALHHVFPEAATPSVYLLYKTS-HYNILYAADK. 236
13 -35.2002zfy_A mol:protein length:234 Ubiquitin thioesterase OTUB1  ali model follow..  14  1.............GSEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLH-YIRKTRPDGNCFYRAFGEALLDDSKELQRLRLLTSGYLQRESKFFEHFIEGGVKEFCQQVEPMCKESDHIHIIALAQALSVSIQVEYMDRGE-TNPHIFPEGSEPKVYLLYRPG-HYDILY..... 233
14 -34.4004dhz_A mol:protein length:288 Ubiquitin thioesterase otubain-like  ali model follow..  15  1MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVATL--EIRYIRGDGNCFYRAILEIMLKDRARLEKFRLITSAFLKQNSEEYAPFIDEGVAQYCEQIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTWHYDIPSDDQQIAPEITLLYRPG-HYDVIYKKDST 281
15 -32.6004dhi_B mol:protein length:284 Ubiquitin thioesterase otubain-like  ali model follow..  13  1MANEPQKSDDNGQAAEAVVTDDEIVLQDQQLKTIEDEQKSVPLVATLAPFSILCIRYIRGDGNCFYRAILEIMLKDRARLEKFRLITSAFLKQNSEEYAPFIDEGVAQYCEQIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAHYDIPSDDQQIAPEITLLYRPG-HYDVIYKKDST 277
16 -19.0004ddg_A mol:protein length:399 Ubiquitin-conjugating enzyme E2 D2, Ubiquitin  ali model follow..  15  210......................................................IRKTRPDGNSFYRAFGEALLDDSKELQRLRLLTSGYLQRESKFFEHFIEGTVKEFCQQVEPMCKESDHIHIIALAQALSVSIQVEYMDRGE-TNPHIFPEGSEPKVYLLYRPG-HYDILYK.... 399
17 -17.7005dq6_A mol:protein length:360 Tumor necrosis factor alpha-induced protein 3  ali model follow..  15  78......................................ESQKKLNWCREVRKLVALKTNGDGNCLMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNTRNWNDEWDNLVKMASADTPAAREIHIFVLSNILRRPIIVISVGGIYLPLHWPAQECYRYPIVLGYDSQ-HFVPLVTLKDS 266
18 -17.0003dkb_A mol:protein length:390 Tumor necrosis factor, alpha-induced protein  ali model follow..  17  92......................................ESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKEESLKSQEFVETGLC--YDTRNWNDEWDNEIHIFVLCNILRRPIIVISVGGIYLPLHWPAQECYRYPIVLGYDSH-HFVPLVTLKDS 280

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.