current user: public




Query: 3pfy_A mol:protein length:185 OTU domain-containing protein 5, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MSSGRENLYFQGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKALast
1 -96.0003pfy_A mol:protein length:185 OTU domain-containing protein 5  ali model  100  1MSSGRENLYFQGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKA 179
2 -83.4003tmo_A mol:protein length:184 OTU domain-containing protein 5  ali model follow..  95  2........SHMGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKA 177
3 -69.9003prm_A mol:protein length:178 L protein  ali model follow..  11  2.........................DFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTHSYHYIKRLTESAARKYYQEEPLVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIGDGDVFTAVNLLHSGQTHFDALRILPQF 161
4 -68.1003phu_A mol:protein length:219 RNA-directed RNA polymerase L  ali model follow..  11  1......................GPMDFLRSLDWTQVIAGQYVSNPRFNISDYFEIVRQPGDGNCFYHSIAELTMPNKTDHHYIKRLTESAARKYYQEEPELVGLSLEDYLKRMLSDNEWGSTLEASMLAKEMGITIIIWTVAASDEVEAGIGDGDVFTAVNLLHSGQTHFDALRILPQ. 162
5 -64.8003by4_A mol:protein length:212 Ubiquitin thioesterase OTU1  ali model follow..  16  2..................................KRVLKSTEMSIGGSGENVLSVHPVLDDNSCLFHAIAYGIFKQDS-VRDLREMVSKEVLNNPVKFNDAIDKPNKDYAQWILKMESWGGAIEIGIISDALAVAIYVVDIDAVKIEKF--NEDKFDNYILILFN-GIHYDSLTMNEFK 143
6 -49.4003zrh_A mol:protein length:454 UBIQUITIN THIOESTERASE ZRANB1  ali model follow..  17  152...............QEKLFDEVLDRDVQKELEEESPIINWSLELATRLDSRLYALWNRTAGDCLLDSVLQATWGIYDKDSVLRKALHDSLHDCSHWFYTRWQEDWAFILSLASQPGASLEQTHIFVLAHILRRPIIVYGVKYYKLPLLWEQSFCWKSPIALGYTRG-HFSALVAMEND 352
7 -46.0002zfy_A mol:protein length:234 Ubiquitin thioesterase OTUB1  ali model follow..  13  65..........EALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVETSVADLLASFNDQST-SDYLVVYLRLLTSGYLQRESKFFEHFIEGGVKEFCQQVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTHIFPEGSEPKVYLLY-RPGHYDILYK.... 234
8 -45.7001tff_A mol:protein length:234 Ubiquitin thiolesterase protein OTUB2  ali model follow..  11  62..........ESLLGKSREIFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSSDHIVQFLRLLTSAFIRNRADFFRHFIDEDIKDFCTHVEPMATECDHIQITALSQALSIALQVEYVDEMDTALHHVFPEAATPSVYLLY-KTSHYNILYAADK. 233
9 -43.6004ddg_B mol:protein length:250 OTUB1  ali model follow..  12  81..........EALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTF-IEQVEKQTSVADLLASFNDQST-SDYLVVYLRLLTSGYLQRESKFFEHFIEGGVKEFCQQVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTHIFPEGSEPKVYLLY-RPGHYDILYK.... 250
10 -42.4004dhz_A mol:protein length:288 Ubiquitin thioesterase otubain-like  ali model follow..  107...........KDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGS-ANYILMFFRLITSAFLKQNSEEYAPFIDETVAQYCEQIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGSDDQQIAPEITLLYRPG-HYDVIYKKDST 281
11 -42.3004dhi_B mol:protein length:284 Ubiquitin thioesterase otubain-like  ali model follow..  103...........KDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSAN-YILMFFRLITSAFLKQNSEEYAPFIDETVAQYCEQIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNIPSDDQQIAPEITLLYRPG-HYDVIYKKDST 277
12 -17.7003dkb_A mol:protein length:390 Tumor necrosis factor, alpha-induced protein  ali model follow..  15  84..............................DRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGEWDNEIHIFVLCNILRRPIIVISDKMLRLPLHWPAQECYRYPIVLGYDSH-HFVPLVTLKDS 280

FFAS is supported by the NIH grant R01-GM087218-01
5 7 2 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.