current user: public




3ooiA
Query: 3ooi_A mol:protein length:232 Histone-lysine N-methyltransferase, H3 lysine, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst SKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGLast
1 -113.0003ooi_A mol:protein length:232 Histone-lysine N-methyltransferase, H3 lysine  ali model  100  1SKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLG 232
2 -98.7003h6l_A mol:protein length:278 Histone-lysine N-methyltransferase SETD2  ali model follow..  37  22.RDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDKRMQCECTPLSKDEIACGEDCLNRLLMIECSSR-CPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLG 257
3 -97.5003ope_A mol:protein length:222 Probable histone-lysine N-methyltransferase A  ali model follow..  42  1.................GSYKKIRSNVYVDVKPL---SGYEATTCNCKKPDDDRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNH-SDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEQQLCKCGFEKCRGIIG 214
4 -88.9003bo5_A mol:protein length:290 Histone-lysine N-methyltransferase SETMAR  ali model follow..  27  26.......VGAWPPGAAPAPFQYTPDHVVGPGAD-IDPTQITFPGCICVKTPCLPGTCGSGGKYAEPVFECNVL-CRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMPKLALFAAKDIVPEEELSYDYSGRDHGKLRKPCYCGAKSCTAFLP 286
5 -88.6002w5y_A mol:protein length:192 HISTONE-LYSINE N-METHYLTRANSFERASE HRX  ali model follow..  28  2........................................PLGSHMHRPPEYNPNDEEEEEVQLKSARRATS--MDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGI-GCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDSNKLPCNCGAKKCRKFLN 192
6 -87.8003k5k_A mol:protein length:283 Histone-lysine N-methyltransferase, H3 lysine  ali model follow..  25  26.....PCVNGVDGEPCPEDYKYISENCETSTMN-IDRNITHLQHCTCVDDCSSSLLQEFNKIEPPLIFECNQA-CSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYL----FDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQPRIAFFSSRDIRTGEELGFDYGDRDIKSKYFTCQCGSEKCKHSAE 270
7 -87.0001ml9_A mol:protein length:302 Histone H3 methyltransferase DIM-5  ali model follow..  30  13.....SIVNREDDAFLNPNFRFIDHSIIGKNVPV--ADQSFRVGCSCASDEECMLLRDRVLQSQEPIYECHQG-CACSKDCPNRVVERGRTVPLQIFRTKDRGWGVKCPVNIKRGQFVDRYLGEIITSEEADRRRAESTIARRKDVYLFALDKFLEVDGEYMSGPTRFINHSCDPNMAIFARVGDHAHDLALFAIKDIPKGTELTFDYVNGLTGLEMTKCLCGTAKCRGYL. 301
8 -85.3003hna_A mol:protein length:287 Histone-lysine N-methyltransferase, H3 lysine  ali model follow..  25  45.....PCVNAVDSEPCPSNYKYVSQNCVTSPMN-IDRNITHLQYCVCIDDCSSSLLPEFNMAEPPLIFECNHA-CSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYL----FDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQPRIAFFSTRLIEAGEQLGFDYGERFWDGKLFSCRCGSPKCRH... 286
9 -84.8002r3a_A mol:protein length:300 Histone-lysine N-methyltransferase SUV39H2  ali model follow..  31  45.....FVENTVDLEGPPSDFYYINEYKPAPGISL---VNEATFGCSCTDCFFQKCNQQIKIPPGTPIYECNSR-CQCGPDCPNRIVQKGTQYSLCIFRTSNRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLPRIALFSTRTINAGEELTFDYQMKGSGDVRTVCKCGAVTCRGYLN 300
10 -84.6001mvh_A mol:protein length:299 Cryptic loci regulator 4  ali model follow..  28  31.....TLVNEVDDEPCPSDFQFISQYRLTQGVIP--PDPNFQSGCNCSSLGGCDLNNPSRCDTGAVIYECNSF-CSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGYDLAFFAIKDIQPLEELTFDYAGARISKLRRQCKCGSANCRGWLF 298
11 -74.0001zkk_A mol:protein length:167 Histone-lysine N-methyltransferase, H4 lysine  ali model follow..  21  1.........................................................GAMGSSR----KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGYYFQYLSKTYCVDATRETNLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASEAHPWLK.......... 166
12 -69.3003s8p_A mol:protein length:273 Histone-lysine N-methyltransferase SUV420H1  ali model follow..  18  86.......................................................EHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRH----GENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNC---KFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGA 269
13 -65.4002f69_A mol:protein length:261 Histone-lysine N-methyltransferase, H3 lysine  ali model follow..  17  70...................................................TEEGRPHFELMPGNSVYHFDKSTSSCI--STNALLPESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWAL------NGNTLSLDEETVIDVPEPASLGHKANHSFTPNCIYDMFVHPRFPIKCIRTLRAVEADEELTVAYGYDHSPPGKSEAPEWYQVELKAFQ 256
14 -65.2003rq4_A mol:protein length:247 Histone-lysine N-methyltransferase SUV420H2  ali model follow..  16  23..............DPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQ------RDLEAAYRALTLGGWTARYFQSRGPRQEAALKTHTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGEND-----FSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPA---DGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTRKGEGAFR 242
15 -64.9001xqh_A mol:protein length:264 Histone-lysine N-methyltransferase, H3 lysine  ali model follow..  17  73...................................................TEEGRPHFELMPGNSVYHFDKSTSSCI--STNALLPESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWAL------NGNTLSLDEETVIDVPEPASLGHKANHSFTPNCIYDMFVHPRFPIKCIRTLRAVEADEELTVAYGYDHSPPGKSEAPEWYQVELKAFQ 259
16 -46.1001n3j_A mol:protein length:119 Histone H3 Lysine Methyltransferase  ali model follow..  20  3..........................................................................................NDRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALED---------YLFSRKN---MSAMALGF-GAIFNHSKDPNARHE--LTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPRLT............ 117
17 -43.6002jv0_A mol:protein length:163 PR domain zinc finger protein 2  ali model follow..  13  12........................................................................AATETLAEVPEHVLRGPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMC-----IDATDPEKGNWLRYVNWACSGEEQ-NLFPLEINRAIYYKTLKPIAPGEELLVWYDGEDNPEIAAAIEEERASARS... 163
18 -41.7002qpw_A mol:protein length:149 PR domain zinc finger protein 2  ali model follow..  15  11........................................................................AATETLAEVPEHVLRGPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMC-----IDATDPEKGNWLRYVNWACSGEEQ-NLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPE................. 148
19 -38.8003dal_A mol:protein length:196 PR domain zinc finger protein 1  ali model follow..  15  23..............................................TEAEFEEKCT---------YIVNDHPWDSGADGGTSVQAEAS-RNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSR---ELHHFIDGFNEEKSNWMRYVNSPREQNLAA----CQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNL... 194
20 -35.5003ep0_A mol:protein length:170 PR domain zinc finger protein 12  ali model follow..  15  4...................................................................FTAEVLAQSFSGEVQKLSSLV-AEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEV---FNEDGTVRYFIDASDHRSWMTYIKCARNEQ-EQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEDQ.... 163
21 -34.9003db5_A mol:protein length:151 PR domain zinc finger protein 4  ali model follow..  15  8................................................................................VPDTPIESRARLSLP--SIVGAEVGVWTGETIPVRTCFGPLIGQQSHSMEVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNRE-EQNLVAYPHDGKIFFCTSQDIPPENELLFYYS------RDYAQQIGVPE...... 151
22 -34.4003ihx_A mol:protein length:152 PR domain zinc finger protein 10  ali model follow..  13  8................................................................................IPNRPVLTRARASLLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPLVRGSELKDCYIHLKSLDKGDRKERDLHEDLWFELSDLCNWMMFVRPAQNHL-EQNLVAYQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKI............ 150
23 -28.2001n6c_A mol:protein length:297 SET domain-containing protein 7  ali model follow..  22  153.................................................................................................LISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSR------DWALNGNTLSLDEETVIDVPEPASLGHKANHSFTPNCIYDMFVHPRFGPIKIRTLRAVEADEELTVAYGYDHSPPGKSG............. 277
24 -23.1003ray_A mol:protein length:237 PR domain-containing protein 11  ali model follow..  14  26.....................................QQVDFWFCECQEYFVD------ECPNHGPPVFVSDTPVPVGIP---DRAALTIPQGMEVVKDTGESDVRCVNEVIPKGHIFGPYEGQISTQDKSAGFFSWLIVDKNNRYKSIDGSDE------TKANWMRYVVISREER-EQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDARGEKRLQRKSEQV....... 217
25 -19.4003oxg_A mol:protein length:464 SET and MYND domain-containing protein 3  ali model follow..  15  79............................................CDCLLGKEKLMRCS----------QCRVAK--CSAKCQKKAWPDHKRECKCLKSCKPR---FKLMDGAPSESEKLYSFYDLESNINKLTEDRKEGLRQLVMTFQHFMRNSFTICNAEMQEVGVLLNHSCDPNCSIV-----NGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRCDC--FRCQ.... 297
26 -19.0003n71_A mol:protein length:490 Histone lysine methyltransferase SmyD1  ali model follow..  17  52............................................CHCFKRQEKLHRCG----------QCKFAHY-CDRTCQKDAWLNHKNECAAIKKYGKV---RVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKELRVDVDTFLINCNGFTLSDQRGLQAVGVLVNHDCWPNCEAVKSMFHTQMRIELRALGKISEGEELTVSYIDFLHLSEERRCSC--EHCQ.... 280
27 -18.8003rib_A mol:protein length:441 N-lysine methyltransferase SMYD2  ali model follow..  15  52............................................CECFTRKEGLSKCG----------RCKQAFY-CNVECQKEDWPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVA-LMNHSCCPNVIVT-----KGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNCEC--QECT.... 268
28 -18.2003qwv_A mol:protein length:433 SET and MYND domain-containing protein 2  ali model follow..  14  52............................................CECFARKEGLSKCG----------RCKQAFY-CDVECQKEDWPLHKLECSSMVVLGEN--EFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNNGFTIEDEELSHLGSLMNHSCCPNVIVT-----KGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNCEC--RECT.... 268
29 -18.1003ru0_A mol:protein length:438 SET and MYND domain-containing protein 3  ali model follow..  16  51........................................................CDRCLLGKEKLMRC--SQCRCSAKCQKKAWPDHKRECKCLKSCKPR--DLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNSISLLNHSCDPNCSIV-----NGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRCDC--FRCQ.... 269
30 -12.0001h3i_A mol:protein length:293 HISTONE H3 LYSINE 4 SPECIFIC METHYLTRANSFERAS  ali model follow..  20  171.................................................................................................LISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFV---HPRFGIRTLRAVEADEELTVAYGYDHSPPGK............... 293

FFAS is supported by the NIH grant R01-GM087218-01
6 2 7 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.