current user: public




Query: 3ooi_A mol:protein length:232 Histone-lysine N-methyltransferase, H3 lysine, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst SKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGLast
1 -121.0003ooi_A mol:protein length:232 Histone-lysine N-methyltransferase, H3 lysine  ali model  100  1SKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLG 232
2 -120.0004yz8_A mol:protein length:233 Histone-lysine N-methyltransferase NSD3  ali model follow..  75  2QRESKEALEIEKNSRKPPPYKHIKANKVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTFNYNLDCLGNGRTECHCGADNCSGFLG 233
3 -106.0004ynm_A mol:protein length:226 Histone-lysine N-methyltransferase ASH1L  ali model follow..  41  1.............GAMAGSYKKIRSNVYVDVKP---LSGYEATTCNCKKPDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNH-SDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQLCKCGFEKCRGIIG 218
4 -102.0004fmu_A mol:protein length:278 Histone-lysine N-methyltransferase SETD2  ali model follow..  37  22.RDPQRWKECAKQGKMPCYFDLIEENVYLTERKKKSHRDIKRMQCECTPLSKDEIACGEDCLNRLLMIECSSR-CPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLG 257
5 -83.0005czy_A mol:protein length:483 Legionella effector LegAS4  ali model follow..  21  1...................MTHLPGNIYT-----------LFTPVNGPKSKDEWIDTSKIMLDLHIDNMSSSDYIP----SAIDRTDLVMVQSVHLLRKT-GGRGLFAREDIPKGTCIGIYTGEVYSEQEFEQYLKEHVGS--DKSYAMYVG-GRVIDAARKGNLTRYINFSSQDNAEFVETTLNRKKVAKVITTKNIKAGQQLLINYNT--YEEQASRYYYFLNPGDGWLS 193
6 -82.9004o30_A mol:protein length:234 Histone-lysine N-methyltransferase ATXR6, put  ali model follow..  19  3MGSRRRSGSLVYQKRRRRLLPFVSSEDPAQRLKQMGTLASALTELQMEFSDDAPRSANQARFEEGGMQVLTKEDIETLEQCRAM-CKRGDCPPLLVVFDSREGFTVEADGQIKDMTFIAEYTGDVDY---IRNREHDDCDSMMTLLLAKDPSKSLVICPDKRGNIARFINHTLDQNCKCVRYSVNGECRVFLVATRDIAKGERLYYDYNGYEHEYPTQHF............ 233
7 -76.1004mi0_A mol:protein length:233 Histone-lysine N-methyltransferase EZH2  ali model follow..  28  26..........................................KFCQCSSECQNAQCNTKQCPCYLAVRECDPDLCSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYM--CSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYR---YSQADALKYVGIEREMEI.. 226
8 -75.3004mi5_A mol:protein length:229 Histone-lysine N-methyltransferase EZH2  ali model follow..  28  30............................................CQCSSECQNAQCNTKQCPCYLAVRECDPDLCSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYM--CSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYR---YSQADALKYVGIEREMEI.. 228
9 -66.6005hq2_M mol:protein length:202 N-lysine methyltransferase SETD8  ali model follow..  18  1........................GSAKQALKKPIKGKQAPRKKAQGKTQQNRKL--TDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGYYFQYLSKTYCVDATRETNLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSASIEAFPWLK.......... 201
10 -65.0001zkk_A mol:protein length:167 Histone-lysine N-methyltransferase, H4 lysine  ali model follow..  21  1.........................................................GAMGSSRKSKAELQS----EERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDGCYMYYFQYLSKTYCVDATRETNLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDSKASIEAHPWL........... 165
11 -63.8004bup_A mol:protein length:271 HISTONE-LYSINE N-METHYLTRANSFERASE SUV420H1  ali model follow..  15  33THKMNTSAFPSRSSRHISKADSFSHNNPVRFRPIKGRQ-EELKEVIERFKKD---EHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRH----GENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNC---KFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGA 267
12 -63.0003s8p_A mol:protein length:273 Histone-lysine N-methyltransferase SUV420H1  ali model follow..  15  35THKMNTSAFPSRSSRHFSKSDSFSHNNPVRFRPIKGRQEELKEVIERFKKD----EHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRH----GENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNC---KFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGA 269
13 -60.6003bo5_A mol:protein length:290 Histone-lysine N-methyltransferase SETMAR  ali model follow..  27  30...........PPGAAPAPFQYTPDHVV-GPGADIDPTQITFPGCICV----KTPCLPGTCSYAEPVFECNVL-CRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVKLALFAAKDIVPEEELSYDYSGRDHGKLRKPCYCGAKSCTAFL. 285
14 -60.4001mvh_A mol:protein length:299 Cryptic loci regulator 4  ali model follow..  28  33......VNEVDDEPCPSLDFQFISQYRLTQGVI--PPDPNFQSGCNCSSLGGCDLNNPSRCETGAVIYECNSF-CSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDATVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHG-DLAFFAIKDIQPLEELTFDYAGARISKLRRQCKCGSANCRGWL. 297
15 -60.2005hyn_A mol:protein length:746 Histone-lysine N-methyltransferase EZH2  ali model follow..  24  507.QLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVI---AQNFCEKFCQCSSECQNAQCNTKQCPCYLAVRECDPDLCSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYM--CSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYR---YSQADALKYVGIEREMEI.. 745
16 -59.0001ml9_A mol:protein length:302 Histone H3 methyltransferase DIM-5  ali model follow..  29  19...........DDAFLNPNFRFIDHSIIGKNVPVADQSFRMYSTCQCLDEMAPDSDEEADPYTQEPIYECHQG-CACSKDCPNRVVERGRTVPLQIFRTKDRGWGVKCPVNIKRGQFVDRYLGEIITSEEADRRRAESTIARRKDVYLFALDKFSEVDGEYMSGPTRFINHSCDPNMAIFARVGDHAHDLALFAIKDIPKGTELTFDYVNGLTGSEMTKCLCGTAKCRGYL. 301
17 -57.4003rq4_A mol:protein length:247 Histone-lysine N-methyltransferase SUV420H2  ali model follow..  16  23..............DPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQ------RDLEAAYRALTLGGWTARYFQSRGPRQEAALKTHTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGEND-----FSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPA---DGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEGA 240
18 -56.2002r3a_A mol:protein length:300 Histone-lysine N-methyltransferase SUV39H2  ali model follow..  32  51...........DLEGPPSDFYYINEYKPAPGI---SLVNEATFGCSCTDCFFQKCCPAEA--PGTPIYECNSR-CQCGPDCPNRIVQKGTQYSLCIFRTSNRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFVDAARYGNVSHFVNHSCDPNLQVFNVFIDNL-RIALFSTRTINAGEELTFDYQMKAKKRVRTVCKCGAVTCRGYL. 299
19 -55.9005ch1_B mol:protein length:937 putative polycomb protein Ezh2,putative polyc  ali model follow..  29  535.......................................LKFTGCACHSSGKTRQREGRPCICVQLNRECDPTLCKHSTGCQNVALQRGAAKAVVLGKSEACGYGLFAAEDIEEGEFVIEYTGELISHDEGVRREHRFDEENKVSYLFLLEQEGIWVDAAIYGNLSRYINHATDGNIMPKIMYVNHEWRIKFTAIKDIKAGEELFFNYGDNFPNLTKKLVERNEQSGAETTP 755
20 -55.7004au7_A mol:protein length:247 HISTONE-LYSINE N-METHYLTRANSFERASE SUV420H2  ali model follow..  16  25..............DPYLGFRTHKMNVSPVPTL--RRQHHLRSALEAFLRQRDL----EAAFRALTLGGWMAHYFQSRAPRQEAALKTHTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREEDEDLLRAGEN-----DFSIMYSTRKRSAQLWLGPAAFINHDCKPNC---KFVPSDGNTACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTRKGEGAFR 244
21 -55.5005ij7_A mol:protein length:643 Enhancer of Zeste Homolog 2 (EZH2),Histone-ly  ali model follow..  28  452.......................................NRFPGCRCK-----AQCNTKQCPCYLAVRECDPDLCSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYM--CSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYR---YSQADALKYVGIEREMEI.. 642
22 -55.3003hna_A mol:protein length:287 Histone-lysine N-methyltransferase, H3 lysine  ali model follow..  28  51...........DSEPCPSNYKYVSQNCVTSPMNI-DRNITHLQYCVCIDDSSSNCMCGQL--EPPLIFECNHA-CSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVR--------EEDSYLFDLDNKDCIDARFYGNVSRFINHHCEPNLVPVRVFMAHQPRIAFFSTRLIEAGEQLGFDYGFWDIKGKLFSCRCGSPKCRH... 286
23 -55.1004nvq_A mol:protein length:285 Histone-lysine N-methyltransferase EHMT2  ali model follow..  27  34...........DGEPCPEDYKYISENCETSTMNI-DRNITHLQHCTCVDDKDGRLLQEFNKIEPPLIFECNQA-CSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVR--------EDDSYLFDLDNKDCIDARYYGNISRFINHLCDPNIIPVRVFMLHQPRIAFFSSRDIRTGEELGFDYGFWDIKSKYFTCQCGSEKCKHSA. 271
24 -52.9002w5y_A mol:protein length:192 HISTONE-LYSINE N-METHYLTRANSFERASE HRX  ali model follow..  33  44...................................................................................RHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGI-GCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKPCNCGAKKCRKFLN 192
25 -50.6005f5e_A mol:protein length:158 Histone-lysine N-methyltransferase 2A  ali model follow..  33  10...................................................................................RHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGIVIRSILTDKREKYYDSKGI-GCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKPCNCGAKKCRKFLN 158
26 -50.3005f6k_C mol:protein length:159 Histone-lysine N-methyltransferase 2C  ali model follow..  27  5.............................................................................SKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNR-GVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFD--DQHKIPCHCGAVNCRKWMN 159
27 -49.9004nj5_A mol:protein length:518 Probable histone-lysine N-methyltransferase,  ali model follow..  21  271...........DSDQEPLYYEYLAQTSFPPGLFV--QQSGNASGCDCVNGCGSGCLCEAKNSGEILIHECGSA-CQCPPSCRNRVTQKGLRNRLEVFRSLETGWGVRSLDVLHAGAFICEYAGVALTREQANILTMNGDTLVYPARFSSARWEDWAMDVSKMRNVACYISHSTDPNVIVQFVLHDHN-RVMLFAAENIPPMTELSLDYGVV-DDWNAKLAICN......... 518
28 -49.8004qen_A mol:protein length:533 Histone-lysine N-methyltransferase, H3 lysine  ali model follow..  29  261.........DDSPVSPTSGFTYIKSLIIEPNVIIP----KSSTGCNCR----GSCTDSKKCASRDVVFECGPH-CGCGPKCVNRTSQKRLRFNLEVFRSAKKGWAVRSWEYIPAGSPVCEYIGVVRRTADVDTISDNEYIFEIDCQQTMQGLGGRCIDAGSTGNFARFINHSCEPNLFVQCVLSSHQARVVLFAADNISPMQELTYDYGYA--KVKQLACYCGALNCRKRL. 532
29 -49.7004z4p_A mol:protein length:166 Histone-lysine N-methyltransferase 2D  ali model follow..  27  11...................................................................................RRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNR-GIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFD--DQHEIPCHCGAWNCRKWM. 158
30 -44.4004ldg_A mol:protein length:278 Protein with a SET domain within carboxy regi  ali model follow..  23  129..................................................................................KYCILNEIHSCTLIKKDAFKGRCVIAGSLIRKDDFVLEYKGNLITQNEAKELEEKYALSNR--YYFKANDKNYCIDATEEFGPGRLINHSKNPNIITKVLMIENTPRLFFVSKRDIICGEELLFDYGDNN-STLHNPWLVNS........ 278
31 -42.4005ayf_A mol:protein length:263 Histone-lysine N-methyltransferase SETD7  ali model follow..  19  91.......................................................................DKSTSSCISTNALLPDPYESERVYVAESLSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNG------NTLSLDEETVIDVPEPASLGHKANHSFTPNCIYDMFVHPFGPIKCIRTLRAVEADEELTVAYGXX..................... 235
32 -41.5005eg2_A mol:protein length:262 Histone-lysine N-methyltransferase SETD7  ali model follow..  20  108.......................................................................................ESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNG------ATLSLDEETVIDVPEPYNLGHKANHSFTPNCIYDMFVHRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGYQVELKAFQA... 258
33 -41.4004e47_A mol:protein length:264 Histone-lysine N-methyltransferase SETD7  ali model follow..  20  104.......................................................................................ESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNG------NTLSLDEETVIDVPEPYNLGHKANHSFTPNCIYDMFVHRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGYQVELKAFQA... 254
34 -41.3001xqh_A mol:protein length:264 Histone-lysine N-methyltransferase, H3 lysine  ali model follow..  20  110.......................................................................................ESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNG------NTLSLDEETVIDVPEPYNLGHKANHSFTPNCIYDMFVHRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGYQVELKAFQA... 260
35 -39.8003vuz_A mol:protein length:263 Histone-lysine N-methyltransferase SETD7  ali model follow..  20  109.......................................................................................ESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNG------NTLSLDEETVIDVPEPASLGHKANHSFTPNCIYDMFVHRFGPIKCIRTLRAVEADEELTVAYGYD..................... 235
36 -36.9004rz0_A mol:protein length:146 PFL0690c  ali model follow..  16  1.......................................................................................NDIQKKIYIGKSSLGGLGVFSLEGIKKNEIIEICPTVSICNEEIPRNLVDYLYEGKEPSIIINRKKETSNYKLLPLGYGILYNHSDIPNAYVEIHKINSNNVMIVYAYNNIQKDDEILISYGHSWW................... 145
37 -32.4001n3j_A mol:protein length:119 Histone H3 Lysine Methyltransferase  ali model follow..  18  4...........................................................................................DRVIVKKSPLGGYGVFARKSFEKGELVEECLCIVRHNDDWGTALED---------YLFSRKNMSAMA----LGFGAIFNHSKDPNARHE--LTAGLKRMRIFTIKPIAIGEEITISYGDDYWLSRPR.............. 115
38 -15.8005ccl_A mol:protein length:432 Histone-lysine N-methyltransferase SMYD3  ali model follow..  15  2EPLKVEKFATANRGNGLRAVTPLRPGELLFRSDPLAY-CKGSRGVVC-----------DRCLLGKELMRC--SQCRCSAKCQKKAWPDHKREKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQ--SISLLNHSCDPNCSI----VFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRCDC--FRCQ.... 267
39 -15.5005ex3_A mol:protein length:436 Histone-lysine N-methyltransferase SMYD3  ali model follow..  16  15.....EKFATANRGNGLRAVTPLRPGELLFRSDPLAY-CKGSRGVVC-----------DRCLLGKKLMRC--SQCRCSAKCQKKAWPDHKREKLYSFYDLESNINKLTEDRKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQ--SISLLNHSCDPNCSI----VFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRCDC--FRCQ.... 275
40 -15.5003ru0_A mol:protein length:438 SET and MYND domain-containing protein 3  ali model follow..  16  9.....EKFATANRGNGLRAVTPLRPGELLFRSDPLAY-CKGSRGVVC-----------DRCLLGKKLMRC--SQCRCSAKCQKKAWPDHKREKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQ--SISLLNHSCDPNCSI----VFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRCDC--FRCQ.... 269
41 -15.5003oxg_A mol:protein length:464 SET and MYND domain-containing protein 3  ali model follow..  16  37.....EKFATANRGNGLRAVTPLRPGELLFRSDPLAY-CKGSRGVVC-----------DRCLLGKELMRC--SQCRCSAKCQKKAWPDHKREKLYSFYDLESNINKLTEDRKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQ--SISLLNHSCDPNCSI----VFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRCDC--FRCQ.... 297
42 -15.2001n6c_A mol:protein length:297 SET domain-containing protein 7  ali model follow..  24  153.................................................................................................LISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNG------NTLSLDEETVIDVPEPYNLGHKANHSFTPNCIYDMFV---HPRFGIRTLRAVEADEELTVAYGYD..................... 269
43 -15.2003n71_A mol:protein length:490 Histone lysine methyltransferase SmyD1  ali model follow..  14  10.....EVFTSEGKGRGLKATKEFWAADVIFAERAYSFDSLINFVC-------------HTCFKRQEKLRC--GQCKCDRTCQKDAWLNHKNECAAIKKYGKV---IMWRVEREGTGLTEGCLVSVDDLQNHVEHFGEEEQKELRVFGVINCNGFTLSDQRGLQAVGVLVNHDCWPNCTVI--MFHTQMRIELRALGKISEGEELTVSYIDFLHLSEERRCSC--EHCQ.... 280
44 -14.7004ynd_A mol:protein length:461 N-lysine methyltransferase SMYD2  ali model follow..  15  11TENLYFQGAMDPMRAEGLGGLERFCSPGKGRGLRALQPFQNERGNHC-----------EYCFTRKGLSKC--GRCKCNVECQKEDWPMHKLECSPMVVFGEN----TPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFMNHSCCPNVIV----TYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNCEC--QECT.... 290
45 -14.1003rib_A mol:protein length:441 N-lysine methyltransferase SMYD2  ali model follow..  14  5GLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYATVNERGNHCE-------------YCFTRKGLSKC--GRCKCNVECQKEDWPMHKLE-ARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFMNHSCCPNVIV----TYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNCEC--QECT.... 268
46 -13.9003qwv_A mol:protein length:433 SET and MYND domain-containing protein 2  ali model follow..  17  53..........................................................ECCFARKGLSKC--GRCKCDVECQKEDWPLHKLECSSMVVLGEN----TPSEKLLAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKYLEFPDHSSLVVLFAQVNCNGFMNHSCCPNVIV----TYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNCEC--RECT.... 268
47 -11.8002qpw_A mol:protein length:149 PR domain zinc finger protein 2  ali model follow..  21  32............................................................................................RLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWM-------CIDATEKGNWLRYVNWACSGE-EQNLFPLEINRAIYYKTLKPIAPGEELLVWYN....................... 142
48 -11.5002jv0_A mol:protein length:163 PR domain zinc finger protein 2  ali model follow..  20  33............................................................................................RLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWM-------CIDATEKGNWLRYVNWACSGE-EQNLFPLEINRAIYYKTLKPIAPGEELLVWYD....................... 143
49 -11.3003dal_A mol:protein length:196 PR domain zinc finger protein 1  ali model follow..  17  62.............................................................................................FKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDT-------VPKNANRKYFWRIYSRGEFIDGFEKSNWMRYVNPAHSPR-EQNLAACQNGMNIYFYTIKPIPANQELLVWYC....................... 174
50 -11.3005ecj_A mol:protein length:309 PR domain zinc finger protein 14,Protein CBFA  ali model follow..  21  71...................................................................................................DVPHFGVFCSDFIAKGVRFGPFRGRVVNASEVKAHR--------DNSRMWEIFEDHFIDGKGSGNWMSYVNCARFPK-EQNLLAVQHQGQIFYESCRDIQRNQELLVWYG....................... 175
51 -10.8003ep0_A mol:protein length:170 PR domain zinc finger protein 12  ali model follow..  19  31.............................................................................................IAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNFNEDGTVRYF---------IDASDHRSWMTYIKCARNEQ-EQNLEVVQIGTSIFYKAIEMIPPDQELLVWYG....................... 144
52 -10.3003ihx_A mol:protein length:152 PR domain zinc finger protein 10  ali model follow..  12  15......................................................................................TRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPLVRGSELKDCYIHLKVSLDKGDRKER-HEDLWFELSTLCNWMMFVRPAQNHL-EQNLVAYQYGHHVYYTTIKNVEPKQELKVWYA....................... 139
53 -9.7203db5_A mol:protein length:151 PR domain zinc finger protein 4  ali model follow..  14  31..................................................................................................IVGAEVGVWTGETIPVRTCFGPLIGQQSHSME----VAEWTDKAVNHIWKIYHNGVFCIITTNECNWMMFVRKARNRE-EQNLVAYPHDGKIFFCTSQDIPPENELLFYYS....................... 140
54 -9.2904c1q_A mol:protein length:175 HISTONE-LYSINE N-METHYLTRANSFERASE PRDM9  ali model follow..  14  1.................................GAMSQDDDYLYCECQNFFIDSCPNHGP-------PLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCY-------EYVDGQSQANWMRYVNCARDDE-EQNLVAFQYHRKIFYRTCRVIRPGCELLVWYG....................... 165

FFAS is supported by the NIH grant R01-GM087218-01
8 5 8 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.