current user: public




3o7bA
Query: 3o7b_A mol:protein length:244 Ribosome biogenesis Nep1 RNA methyltransferas, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst RSDITSLYKKVGENLYFQGMGSAFVFLEASLELIPQKIRGHPAVRADAIRRGKRPEKILLDDSKHHTAMKSLEFREKRGRPDIVHQCLLLLLDSPLRDFEVYVHTLNGEIIWVNRETRLPRNYNRFVGLMEKLFEERRITAGDTTLIEFKDVGLRDIVRGRDVLLFREKGGRFEFSELLDGDVAVCIGAFPHGDFFEETLRELGEFKEVSLGTESYTSLYVTSRVLCEYERVRAHKVGLast
1 -115.0003o7b_A mol:protein length:244 Ribosome biogenesis Nep1 RNA methyltransferas  ali model  100  1RSDITSLYKKVGENLYFQGMGSAFVFLEASLELIPQKIRGHPAVRADAIRRGKRPEKILLDDSKHHTAMKSLEFREKRGRPDIVHQCLLLLLDSPLRDFEVYVHTLNGEIIWVNRETRLPRNYNRFVGLMEKLFEERRITAGDTTLIEFKDVGLRDIVRGRDVLLFREKGGRFEFSELLDGDVAVCIGAFPHGDFFEETLRELGEFKEVSLGTESYTSLYVTSRVLCEYERVRAHKVG 238
2 -84.5003bbd_A mol:protein length:205 Ribosome biogenesis protein NEP1-like  ali model follow..  31  1...................MTYNIILAKSALELIPEEIKNKI-------RKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNH-----LIKMEEKTLEDLLNEAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLS........ 204
3 -74.1002v3j_A mol:protein length:258 ESSENTIAL FOR MITOTIC GROWTH 1  ali model follow..  22  21.ASLVPQAPPVLTSKDKITKRMIVVLAMASLETHKI-----------SSNGPGGDKYVLLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDSPINKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSSEEKLLKVIKNPITDHLPKCRKVTLSFDAPVIRVQDYIEESICVFVGAMARGKDN---FADEYVDEKVGLSNYPLSASVACSKFCHGAEDAWN.... 250
4 -8.5802qwv_A mol:protein length:208 UPF0217 protein VC_A1059  ali model follow..  11  10.......................................................SFILRARSAPTDSQRLLDEIGGKCHTEILAHCMLFTAQSHREDVVIHLVLESTTITVEANEIS-GFHEAALIALLVKALDASVGMGKEQTR---FEALLGELAEHHSLYMMDKKGDSIRDIKI-GPNPCFILTDHIPMPKKSGNSMKRLGVEKISLGPKMLFASQCVTLIHNEIDHQ...... 204
5 -7.6302qmm_A mol:protein length:197 UPF0217 protein AF_1056  ali model follow..  18  1...................................................SNAVRGFLIVGNKAFTQPFSLNDLPGAGRMDVLCRCTLFISHGIRRDVEVYLLLLGPILIKGDEVRRMSPDERNVAGHIKKALAVECGKSWKKVHSGVYVSRIEELSEKYSIIYLKEDGVDISNAQ-LPPNPLFVIG--DHEGLTEEQEKERYAALKLSLSPLSLLAEQCVVIAHHHLDRL...... 195
6 -6.7302o4g_A mol:protein length:247 Three prime repair exonuclease 1  ali model follow..  13  2................................................KPMGHMQTLIFLDLE---------ATGLPSSRPEVTELCLLAVHRRALENTSI--RVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDR.................................................................... 124
7 -6.2103aia_A mol:protein length:211 UPF0217 protein MJ1640  ali model follow..  14  31............................................................................SCGRLDLLCRCVFFLSHDIRRDVVFYAVLYGQIKFVGSELKKVSPDERNIAIFIKKALKKFE--NQSTPGIYVRRLGFRNLVEGKNIYYLHMNGE--DVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCITIIHNVLDK....... 205
8 -6.2103ai9_X mol:protein length:211 UPF0217 protein MJ1640  ali model follow..  14  31............................................................................SCGRLDLLCRCVFFLSHDIRRDVVFYAVLYGQIKFVGSELKKVSPDERNIAIFIKKALKKFE--NQSTPGIYVRRLGFRNLVEGKNIYYLHMNGE--DVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCMTMMHNVLDK....... 205
9 -5.8602v14_A mol:protein length:134 KINESIN-LIKE MOTOR PROTEIN C20ORF23  ali model follow..  15  1.................................................................................DLKDPIKISIPRYVLCGQGKDAHFEFEVKITVLETWTVFRRYSRFREMHKTLKLKKLFGNKDERVIAERRSHLEKYLRDFFSVMLQSATSPLHILTLSKHTICEFSPFFKKGVFDYS........................................ 134
10 -5.8001wdj_A mol:protein length:187 hypothetical protein TT1808  ali model follow..  10  37......WVSPTGGESGRRSLQLAYQLARWNEERGLGVVFDSSTGFKFPDGSILSPDAAFVERGAWEALSEAEREGFPPLAPKAVFEVR--LVDPYARAVEVFRPGKPPLRLEGVERVSLDPELPGFALSLPPLW........................................................................................................ 187

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 7 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.