current user: public




Query: 3o7b_A mol:protein length:244 Ribosome biogenesis Nep1 RNA methyltransferas, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst RSDITSLYKKVGENLYFQGMGSAFVFLEASLELIPQKIRGHPAVRADAIRRGKRPEKILLDDSKHHTAMKSLEFREKRGRPDIVHQCLLLLLDSPLRDFEVYVHTLNGEIIWVNRETRLPRNYNRFVGLMEKLFEERRITAGDTTLIEFKDVGLRDIVRGRDVLLFREKGGRFEFSELLDGDVAVCIGAFPHGDFFEETLRELGEFKEVSLGTESYTSLYVTSRVLCEYERVRAHKVGLast
1 -113.0003o7b_A mol:protein length:244 Ribosome biogenesis Nep1 RNA methyltransferas  ali model  100  1RSDITSLYKKVGENLYFQGMGSAFVFLEASLELIPQKIRGHPAVRADAIRRGKRPEKILLDDSKHHTAMKSLEFREKRGRPDIVHQCLLLLLDSPLRDFEVYVHTLNGEIIWVNRETRLPRNYNRFVGLMEKLFEERRITAGDTTLIEFKDVGLRDIVRGRDVLLFREKGGRFEFSELLDGDVAVCIGAFPHGDFFEETLRELGEFKEVSLGTESYTSLYVTSRVLCEYERVRAHKVG 238
2 -86.7002v3j_A mol:protein length:258 ESSENTIAL FOR MITOTIC GROWTH 1  ali model follow..  22  21.ASLVPQAPPVLTSKDKITKRMIVVLAMASLETHKI-----------SSNGPGGDKYVLLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDSPINKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIDESICVFVGAMARGKDNFADE---YVDEKVGLSNYPLSASVACSKFCHGAEDAWNI... 251
3 -84.0003bbd_A mol:protein length:205 Ribosome biogenesis protein NEP1-like  ali model follow..  32  1...................MTYNIILAKSALELIPEEIKNK-------IRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNH-----LIKMEEKTLEDLLNNAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLS........ 204
4 -82.8005fai_A mol:protein length:232 Ribosomal RNA small subunit methyltransferase  ali model follow..  26  11.DALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVG-----------------KTYELLNCDKHKSILLKNGRDPGEARPDITHQSLLMLMDSPLNRLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQLLHKLSVRAADGPLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELSDPIVFVVGAFAHGKVSVEY-----TEKMVSISNYPLSAALTCAKLTTAFEEVWGV... 231
5 -8.4202qmm_A mol:protein length:197 UPF0217 protein AF_1056  ali model follow..  17  1...................................................SNAVRGFLIVGNKAFTQPFSLNDLPGAGRMDVLCRCTSQALHGIRRDVEVYLLLLGPILIKGDEVRRMSPDERNVAGHIKKALAVECGKSWKKVHSGVYEELIEELSEKYSIIYLKEDGVDISNAQL-PPNPLFVIGDHEGLTEEQEKVVERYAALKLSLSPLSLLAEQCVVIAHHHLDRL...... 195
6 -7.6103aia_A mol:protein length:211 UPF0217 protein MJ1640  ali model follow..  14  31..........................SCGRLDLLCRCVSDA--FLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPD--ERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRL--GFRNLVLEKLEE-----------------------GKNIYYLHMNGE--DVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCITIIHNVLDKK...... 206
7 -7.4103ai9_X mol:protein length:211 UPF0217 protein MJ1640  ali model follow..  14  31..........................SCGRLDLLCRCVSDA--FLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKKVSPD--ERNIAIFIKKALKKFEELDEEQRKDWNQSTPGIYVRRL--GFRNLVLEKLEE-----------------------GKNIYYLHMNGE--DVENVDIENPVFIIGDHIGIGEEDERFLDEIKAKRISLSPLELHANHCMTMMHNVLDKK...... 206
8 -7.3702qwv_A mol:protein length:208 UPF0217 protein VC_A1059  ali model follow..  11  10.......................................................SFILRARSAPTDSQRLLDEIGGKCHTEILAHCMLVLESTRDYSRTITVEANEISDVGGFHEAALIALLVKALDASVGMGKEQTRVVQPGLTVRTIEALLGELAEHHSLYMMDKKGDSIRDIKI-GPNPCFILT--DHIPMPKKSGNSMKRVEKISLGPKMLFASQCVTLIHNEIDHQ...... 204
9 -7.1002o4g_A mol:protein length:247 Three prime repair exonuclease 1  ali model follow..  13  2................................................KPMGHMQTLIFLDLE---------ATGLPSSRPEVTELCLLAVHRRALENTSI--RVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDR.................................................................... 124
10 -7.1003u3y_B mol:protein length:314 Three prime repair exonuclease 1  ali model follow..  12  1...........................................MGSQTLPHGHMQTLIFLDLE---------ATGLPSSRPEVTELCLLAVHRRALENTSI--RVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRAFLQRQPQPCCLVAHNGDR.................................................................... 128

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.