current user: public




Query: 3kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMAVQSYAAPPTPWSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFNARVGAGCVVMMHVLIQDVEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNELQLast
1 -99.9003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model  100  1MGSSSSGLVPRGSHMAVQSYAAPPTPWSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFNARVGAGCVVMMHVLIQDVEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNELQ 223
2 -74.2001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  42  43................SNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHEAVVYVNVHLAEGYKETS............. 247
3 -65.7003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  25  1..............MSDQSGKLLTSVRTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHH-IRIGARTSVQDGSVLHITHASDY---NPGGYPLIIGDDVTIGHQAMLHG-CTIGNRVLIGMKSMIMDAIVEDEVIVAAGATVSPGKVLESGFVYMGTPAKKVRP------ITEKERSFFTYGAGNYVRLKDKHLAEGYDR.......... 189
4 -65.5001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  22  2........................AIYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGD-IEQIYVGKYSNVQDNVSIHT----------SHGYPTEIGEYVTIGHNAMVHG-AKVGNYVIIGISSVILDAKIGDHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLEEIEWTKKNAEIYVELAEKHIKGRKR................... 172
5 -64.8003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  25  1..................SNAMSDTLRPYKNLFPGIGQRVMIDTSSVVIGDVRLADDVGIWPLVVIRGDVNY-VAIGARTNIQDGSVLHVTHKSSS---NPHGNPLIIGEDVTVGHKVMLHG-CTIGNRVLVGMGSIVLDAIIEDDVMIGAGSLVPQHKRLESGYLYLGSPVKQIRP------LSDAERSGLQYSANNYVKWKDDYLSQDN............ 183
6 -64.6003tio_A mol:protein length:183 Protein YrdA  ali model follow..  23  2.......................DVLHPYRDLFPQIGQRVMIDDSSVVIGDVRLADDVGIWPLVVIRGDVHY-VQIGARTNIQDGSMLHVTHKSSY---NPDGNPLTIGEDVTVGHKVMLHG-CTIGNRVLVGMGSILLDAIVEDDVMIGAGSLVPQNKRLESGYLYLGSPVKQIRP------LSDEEKAGLRYSANNYVKWKDEYLDQGN............ 179
7 -64.6003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  22  3.........................IYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGD-VAPTVIGNRVNIQDNSILHQ----------SPNNPLIIEDGVTVGHQVILHS-AIVRKNALIGMGSIILDAEIGEGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELDDIREMERIRREYVEKGQYYKALQQQ................... 172
8 -64.5001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  20  1.....................SNAMIYPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGD-VSPTIIGDRVNVQDQCTLHQ----------SPQYPLILEDDVTVGHQVILHS-CHIKKDALIGMGSIILDAEIGEGAFIGAGSLVSQGKKIPPNTLAFGRPAKVIRELEDRKDMERIRTQYVEKGQYYKSLQK.................... 173
9 -62.7003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  26  18.......................EVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDK-IEVGEGTNIQDNTVVHTDSM---------HGDTVIGKFVTIGHSCILHA-CTLGNNAFVGMGSIVMDAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRM------MTEEEILYLQKSAENYIALSRGYL................ 185
10 -62.5004n27_A mol:protein length:195 Bacterial transferase hexapeptide repeat  ali model follow..  28  1MGSSSSGLVPRGSHM---------PIYAYNGHKPQFRESNWIAPDATLIGKVVVGENAGFWFGAVLRGD-NEPITIGADTNVQEQTIMHT----------DIGFPLTIGAGCTIGHRAILHG-CTIGENTLIGMGAIVLNAKVGKNCLIGAGTLVKEGMEIPDNSLVVGSPARVLRQLDAVEKLRASAKHYVERGHSFMRGME.................... 187
11 -62.4004mfg_A mol:protein length:168 Putative acyltransferase  ali model follow..  23  1.....................SNAMIRDYLEDKPLIDESVFVAKSADVIGNVKIGKDSSIWYNAVVRGD-EGPITIGENTNIQDCSIVHG------------DTETIIGNNVTVGHRSIVHG-CKISDNVLIGMGSIILDAEIGEYTLIGAGTLITSNKKFPPGVLIMGSPGKVVRELEDKKYIDESYEWYLEAAQNQK........................ 167
12 -48.5003tv0_A mol:protein length:194 Dynactin subunit 6  ali model follow..  19  1.....................GSSSMAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAG-PIVIGEGNLIEEQALIINAYPDNITPDTPEPKPMIIGTNNVFEVGCYSQA-MKMGDNNVIESKAYVGRVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT................... 184
13 -48.4005adx_V mol:protein length:165 DYNACTIN SUBUNIT 6  ali model follow..  15  1.....................................SGNKVSRQSVLCGNIVLNGKTIVMNDCIIRGDLAN-VRVGRHCVVKSRSVIRPPFKK--FSKGVAFFPLHIGDHVFIEEDCVVNA-AQIGSYVHVGKNCVIGRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPEQELMIDVTKSYYQKFLPLTQ....................... 164
14 -47.7005adx_U mol:protein length:190 DYNACTIN 5  ali model follow..  21  1.........................MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAG-PIVIGEGNLIEEQALIINAHPDNITPDDSEPKPMIIGTNNVFEVGCYSQA-MKMGDNNVIESKAYVGRVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTER-PQPQTLQLDFLMKILPNYHHLKKTMKGS.............. 184
15 -44.9005afu_U mol:protein length:168 DYNACTIN  ali model follow..  20  1.....................................PGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAG-PIVIGEGNLIEEQALIINAYPDNI--TPDTEKPMIIGTNNVFEVGCYSQA-MKMGDNNVIESKAYVGRVILTSGCIIGACCNLNTFEVIPENTVIYGADCL--RRVQTERPQPTLQLDFLMKILPNYHHLKKTMKGSS............. 168
16 -31.8003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  18  247..............FVEVRQEDFEEVFASGHMASGSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNA-----WMGKGSNAQENCYIINS---------------RLERNCVTAHGGKIIN-AHLGDMIFTGFNSFLQGLKIGDGCVVMPHTIIDEPLEIPAGHLVWGYIISFEEFAKVDGEVTMGRMTFRGKGGPFLDSFKKRIKRI.............. 439
17 -25.6003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  21  48..................................SIGNNVRIDDFCILSGKVTIGSYSHIAAYTALYGGEVG-IEMYDFANISSRTIVYA-------AIDDFSGNALMGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFNVVIGEGVAVGAMSMVK--ESLDDWYIYVGVPVRKIKARKR........................................... 184
18 -22.7004m9c_A mol:protein length:216 Bacterial transferase hexapeptide (Three repe  ali model follow..  18  92.......................................AVQSTNTVILDEVEIGEGSLLCPFTCLTSN----IKIGKFFHANIYSYV--------------AHDCVIGDYVTFAPGAKCNGNIHIEDHAYIGTGAVIKQGTIGKGAIVGMGAVVT--KSVPAGVTVVGNPARILER.............................................. 215
19 -22.3003fs8_A mol:protein length:273 QdtC  ali model follow..  15  90..................................IIGDNFQTGHKVTIRENTKIGNNVKIGTLSDIQHH----VYIGNYVNIHSNVFV--------------GEKSIIKDFVWLFPHVVLTNGVTIELFAVIAARSVVLGIHINEDALVGAGAVVT--KDVPKETVVVGNPAREICSIRKIKNKITGEQVY................................ 237
20 -21.7004ea7_A mol:protein length:220 Perosamine N-acetyltransferase  ali model follow..  20  102.........................................IHPSAVVSPSVRLGEGVAVMAGVAINADS----WIGDLAIINTGAVV--------------DHDCRLGAACHLGPASALAGGVSVGERAFLGVGARVIGVTIGADTIVGAGGVVV--RDLPDSVLAIGVPAKIKGDRS............................................ 220
21 -21.1004m98_A mol:protein length:208 Pilin glycosylation protein  ali model follow..  15  92.......................................VLIHPDATVSPSAIIGQGSVVMAKAVVQAGS----VLKDGVIVNTAATV--------------DHDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQTTVGSGVTAGAGAVI--VCDIPDGMTVAGNPAKPL................................................ 208
22 -20.4003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  91......................................KARIEPGAIIRDHVEIGDNAVIMMNATI----NIGAVIGEGSMIDMNAVL--------------GGRATVGKNCHVGAGAVLAGPVIVEDDVVIGANVVVLEGVVGKGAVVAAGAVVTE---VPPYTVVAGTPARVIKEIDEKTKAKTEIKQELRQL............................ 236
23 -20.3002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  21  81...................................IHKSALISPSAIV----EENAGILIMPYVVINAKA----KIEKGVILNTSSVI--------------EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLNLSLADDSILGGGATL--VKNQDEKGVFVGVPAKRMEGGS............................................ 201
24 -20.1003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  91......................................NARIEPGALIREKVEIGDQAVIMMGAIL----NIGAVVGAGTMIDMGAVL--------------GGRATVGKHCHIGAGTVLAGPVVIENEVVIGANAVVLEGVVGEGAVVAAGAVVVE---VPAHTVVAGVPAKVIKQIDDKTKSKTEILEELRKL............................ 236
25 -19.4003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  21  82...................................IHKSALISPSAIV----EENAGILIMPYVVINAKA----KIEKGVILNTSSVI--------------EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLNLSLADDSILGGGATLV--KNQDEKGVFVGVPAKRM................................................ 198
26 -18.7003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  21  78..............................................IFRGDVRIHKNSKI--KGDIVATKGSKVIIGRRTTIGAGFEV-------------DKCNVTIGHDCMIARDVILHPDIIISSYVWVGRNVSIMGVSVGSGSVIGYGSIVT--KDVPSMCAAAGNPAKIIKR.............................................. 216
27 -18.5003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  13  28..........................YAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVKEEQKSGVVIGKNATIREFATINIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQVKVGEGCMIAGASALS--QDIVPFCLAEGNRAS.................................................. 193
28 -18.5003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  17  38..................................EINQSLDEAERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVM-------------DGAPITIGDHVLIGPSTQFY-PIVIEDDVWIGGNVVINGVTIGARSVVAANSVVN--QDVPPDTLVGGTPARILRSLKD........................................... 188
29 -18.2003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  16  23.........................PYSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVINQQLLTKTVIGDHNIFREYSNIHIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQCFVGDYSMVAGLAKVV--QDVPPYSTVDGNPSTVVGSPEVRNAIKHAYKVIYHSGISTRKALDELEASGNLIEQVKYIIKFFR 249
30 -17.8004r36_A mol:protein length:275 Putative acyl-[acyl-carrier-protein]--UDP-N-a  ali model follow..  16  37..........................FVYIDRNVVIGDNNKIMANANILYGSRIGNGNTIFPGAVIGAIEESTAEIGDNNLIRENVTINVGNNNLLMEGVHVAHDALIGNGCIVGNSTKMAGEIIIDDNAIISANVLMHQCRVGGYVMIQGGCRFS--KDIPPYIIAGREPIAYS-SNEIIENIHNAYRIIYQSGLNTSDALTKVEAEVPASPEIEYIVDFIR 261
31 -17.8002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  18  44..........................................DKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVI-------------DVCEVRIGDHCFIGPGVHIY-PVVIGHNVWIGGRAVINGVTIGDNAVIASGAVVT--KDVPANAVVGGNPAKVIKWLK............................................ 185
32 -17.7004e6t_A mol:protein length:294 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  21  1MGSSSSGLVPRGSHMTTENLYFQGAGTS---NHDLIHSTAIIDPSAVIIGQVTIGAGTKLHSHVVVGGGEETWLEIGNNNLIREHCSLHIGSHNLLMVNTHIAHDCIVGDHNIFANNVGVAGHVHIGDHVIVGGNSGIHQCKIDSYSMIGGASLIL--KDVPAYVMASGNPAHAF-------GINIEGMRRKGWSKNTIQGLREAYK................ 245
33 -17.5003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  17  46..........................................EKREDILRQLFGSVGKQINVEQNIRCDYGYNIHVGENFFANYDCIF-------------DVCKIEIGDNVMLAPNVQIY-PVKIGDNVWIGGGVIITGITIGDNVVIGAGSVVT--KDIPPNTVAVGNPCRVIKKIEE........................................... 188
34 -17.5003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  15  47..........................................NKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYF-------------DGGQITIGDNVFIGPNCGFY-PIHIGSNTWFGGHVAVLGVTIGEGSVIGAGSVVT--KDIPPHSLAVGNPCKVVRKIDN........................................... 189
35 -17.5002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  16  80...................................................LQIQAKTTMGNGEITIAE-KGKISIGKDCMLAHGYEIHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIA------------------GSPAKIVKE.............................................. 191
36 -17.4001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  15  17.........DMCEGLPEKRLRGKTLMYEFNHSHPS------VEKRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTI-------------DDYTVTIGDNVLIAPNVTLS-PITIGNNVWIGSHVVINGVTIGDNSVIGAGSIVT--KDIPPNVVAAGVPCRVIREIND........................................... 187
37 -17.4001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  13  25..........................FCVIGDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVL-KGEYSELIIGEDNLIREFCMINIGDKNLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQVRIAKGCMIAGKSALG--KDVPPYCTVEGNRAFIRGESKDIDFIYALYKRLFRPIPSLRESAKLELEEHANNPFVKEICSFIL 249
38 -17.4004dcl_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  15  44..........................................LKRKVLIDALFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYF-------------DGGQITIGDNVFIGPNCGFY-PIHIGSNTWFGGHVAVLGVTIGEGSVIGAGSVVT--KDIPPHSLAVGNPCKVVRKIDN........................................... 186
39 -17.3004egg_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  15  44..........................................MMRKVLIDALFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYF-------------DGGQITIGDNVFIGPNCGFY-PIHIGSNTWFGGHVAVLGVTIGEGSVIGAGSVVT--KDIPPHSLAVGNPCKVVRKIDN........................................... 186
40 -17.3003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  20  78..................................................NIHVGKSFFANFNCVI---DVCEVRIGDHCMFAPGVHIHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVV-------------------TKDVPNNVVVGGNPAKVIKTIEE........................................... 190
41 -17.1001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  17  53.....................................................FGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVM-------------DVCPIRIGDNCMLAPGVHIY-PVTIGNNVWIGGRAVINGVTIGDNVVVASGAVVT--KDVPDNVVVGGNPARIIKKL............................................. 182
42 -17.0003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  16  1....................................GHMATIHPTAIVDEGARIGAHSRIWHWVHICGGA----EIGEGCSLGQNVFV--------------GNRVRIGNRVKIQNNVSVYDNVFLEDDVFCGPSMVFTNVTIGRYAFVGAGAVVN--KDVPDFALVVGVPAR.................................................. 151
43 -16.8005dem_A mol:protein length:258 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  20  24.........................PWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDEPTRLVIGDHNVIREGVTIHIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQCRIGAHSFSGMGSAIG--KDVPAYVTVFGNPAEARSSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQ 250
44 -16.7003t57_A mol:protein length:305 UDP-N-acetylglucosamine O-acyltransferase dom  ali model follow..  15  30.........................PYCTIGSSVKLGNGCKLYPSSHVFGNTELGESCVLMTGAVVGDELPGYTFIGCNNIIGHHAVV-GVKCQDLKYKHGDECFLCIGNNNEIREFCSIHRSSKPSDKTVIGDNNLIMDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASV................................................... 182
45 -16.5002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  15  21..................................SIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGGEPTRVEIGDRNRIRESVTIHVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQCIIGAHVMVGGCSGVA--QDVPPYVIAQGNHATPFGSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFA 256
46 -16.1004eqy_A mol:protein length:283 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  30..................................QLHETVEVGPYAIVGSNVTIGARTTIGSHSVIEGDEPTRLVIGDRNTIREFTTIHLGDDNWIMAYVHIGHDCRVGSHVVLSSNAQMAGHVEIGDWAIVGGMSGVHQVRIGAHSMLGGASALV--QDIPPFVIAAGNKAEPH-------GINVEGLRRRGFSPDAISALRSAYR................ 231
47 -15.9004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  19  12..................................NIGDNTKVWQFCVILAGAVIGRNCNICANSLIEND----VVIGDNVTIKSGVQIWD--------------GIHIQDDVFIGPNVTFTNKTIVKKGASIGANSTILGILIGENAMVGAGAVIT--KNVPDNAIVIGNPGRITGYVEA........................................... 152
48 -15.8004hur_A mol:protein length:220 Virginiamycin A acetyltransferase  ali model follow..  11  1...........GMNLNNDHGPDPENILPIKGNRNLQFIKPTITNENILVGEYSYYDSKQVLYHYEVIGDK---LIIGRFCSIGPGTTFIMNGANHRMDGSTYPFHLF-EKYMPSLKDLPLKGDIEIGNDVWIGRDVTIMGVKIGDGAIIAAEAVVT--KNVAPYSIVGGNPLKFIRK.............................................. 172
49 -15.8004ihf_A mol:protein length:348 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acy  ali model follow..  18  144..............................GKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQIAANVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINHMEICDKVTVTGMGMVMR-PITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQ................... 340
50 -15.6002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  17  164..............................GAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCIEDDVEIGANTTIDRGRFKHSVVREGSKIDN--AHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITHICIADHVIMMAQTGVTKS--ITSPGIYGGAPARPYQEIHRQVAKVRNLPRLEERIAALEKLVQK................... 360
51 -15.3003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  20  159..............................GARSVIGEGGWLAPRVTLYHDVTIGARVSIQSGAVIGGEIGDDVEIGANTTIDRGALSDTLIGNGVKLDNMIAHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVHIEICDNVFVTGMTMVTR-SITEPGSYSSGTAMQPAAEWKKSAARIRQLDDMARRLQQLEKRLAA................... 355
52 -14.9004e75_A mol:protein length:357 UDP-3-O-acylglucosamine N-acyltransferase  ali model follow..  17  152..................................EVGKDCFIDSYVTITGSSKLRDRVRIHSSTVIGGEIGNDVRIGSNCSIDRGALDNTILEDGVIIDNQIAHNVHIGSNTAIAAKCGIAGSTKIGKNCILAGACGVAHLSIADNVTLTGMSMVTKNISEAGTYSSGTGLFENNHWKKTIVRLRQLADVPLTQITKRLDHIQAQIESLES............ 352
53 -14.3001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  15  3....................PNPMKMYPIEGNKSVQFIKPILEKLENVVGEYSYYDSKQILYHYPILNDK---LKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLF-EKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMGVKIGDGAIVAANSVVV--KDIAPYMLAGGNPANEIKQ.............................................. 166
54 -14.2003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  12  3........................AMNFFTSPFSGIPLDQQVTNPNIIVGKHSYYSGVRYLHPERDDVDK---LVIGSFCSIGSGAVFMMAGNQGHRSDWISTFPFFYDNFADARDGFTRSGDTIIGHDVWIGTEAMIMGVKIGHGAIIASRSVVT--KDVAPYEVVGSNPAKHIKFRFSDVEIAM..................................... 173
55 -14.1005b04_E mol:protein length:458 Probable translation initiation factor eIF-2B  ali model follow..  14  325..................................NLPNYFELNKCIAKLTPEQRLVDVTVSERALVGAD----CMVNEGTTIKDNSNIKKS---------------IIGKNCVIGKGVVVSN-SILMDNIVVEDGVRLESCIVASGAQIGAKSKLRECEIGVDHRVEAGRIARGERLVDMEKIETDMD................................... 458
56 -13.9003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  18  281..................................TIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTSSIGDGAAVGPFTYLRPGTAL---GADGKLGAFVEVKNSTIGTGTKVPHLTYV-GDADIGEYSNIGASSVFVNTTVGSHVRTGSDTFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASE.......... 481
57 -13.9004fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  19  270..................................THGRDITIDTNVIIEGHVILGDRVRIGTGCVLKARLDANCTVGPFARLRPGAEL---AEGAHVGNFVEIKKARLGKGSKAGHLSYL-GDAEIGAGVNIGAGTITCNTIIGDDVFVGSDTLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVH................................. 448
58 -13.9002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  19  267..................................EHGKDVEIDVNVIIEGNVKLGDRVKIGTGCVLKSIVGEKAAIGPFSRLRPGAEL---AAETHVGNFVEIKKSTVGKGSKVNHLTYV-GDSEIGSNCNIGAGVITCNTIIGDDVFVGSDTLVAPVKVANGATIGAGTTITRDVGENELVITRVAQRH................................. 445
59 -13.8002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  20  228..................................FSQNLGNVEDNVKIKGKVIIEEDAEIKSGTYIEG----PVYIGKGSEIGPNSYLRILVEKNKIGASVEVKESVIMEGSKIPHLSYV-GDSVIAEDVNFGAGTLIANAFIGGHVRTGINVILPGVKIGAYARIYPGAVVNRDVGYGEFFKV....................................... 401
60 -13.8001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  19  267..................................THGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKANLAAACTIGPFARLRPGAEL---LEGAHVGNFVEMKKARLGKGSKAGHLTYL-GDAEIGDNVNIGAGTITCNTIIGDDVFVGSDTLVAPVTVGKGATIAAGTTVTRNVGENALAISRVPQTQ................................. 445
61 -13.7001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  13  18.........................................VSNPNIRVGRYSYYSGARYLMPDRDDVDK---LVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHF-AFAGAVNGYQPAGDTLIGHEVWIGTEAMFMGVRVGHGAIIGSRALVT--GDVEPYAIVGGNPARTIRKRFSDGDIQN..................................... 172
62 -13.6001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  19  267..................................EIASEVQIEANVTLKGQTKIGAETVLTNGTYVVSSVADGVIVGPYAHIRPNSSLAQVHIGNFVEVKGS----SIGENTKAGHLTYI-GNCEVGSNVNFGAGTITVNTVIGNNVFVGSNSIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKDEYATRLPHHPKNQ.................. 459
63 -13.6001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  19  270..................................EIAPEVQIEANVILKGQTKIGAETVLTNGTYVVSSVADGVTVGPYAHIRPNSSLAQVHIGNFVEVKGS----SIGENTKAGHLTYI-GNCEVGSNVNFGAGTITVNTVIGDNVFVGSNSIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKDEYATRLPHHPKNQ.................. 462
64 -13.5001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  22  125......................................ALYLQNQISVAFDVDIHPAAKIGHGIMF--DHATGIVVGETSVIENDVILQGVTLGGTGKESGDRHP-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS.................................................................. 241
65 -13.5001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  22  127......................................ALYLQNQISVAFDVDIHPAAKIGHGIMF--DHATGIVVGETSVIENDVILQGVTLGGTGKESGDRHP-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS.................................................................. 243
66 -13.4003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  21  132......................................AIYLQNQVSVAFGVDIHPAATIGCGIML--DHATGIVIGETAVVENDVILQSVTLGGTGKTSGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVG.................................................................. 248
67 -13.3004h7o_A mol:protein length:281 Serine acetyltransferase  ali model follow..  23  129......................................ATYFQNQISVACQVDIHPAARIGRGIML--DHATGIVIGETAVVEDDVILQDVTLGGTGKECGDRHP-KIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVG.................................................................. 245
68 -13.3004hzd_A mol:protein length:282 CysE, serine acetyltransferase  ali model follow..  23  139......................................AYYLQSRSSSIFQTDIHPAARLGSGLFL--DHATGLVVGETAVVEDNVILHGVTLGGTGKSSGDRHP-KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIG.................................................................. 255
69 -13.2004n69_A mol:protein length:286 Serine Acetyltransferase Apoenzyme  ali model follow..  24  140......................................ALALHSRIANVFAVDIHPAARIGKGILF--DHATGVVVGETAVIGNNVILHHVTLGGTGKVGGDRHP-KIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVPPRTTAVGNPARLVGGK................................................................ 258
70 -13.2001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  20  139......................................AIFLQNQVSVTFQVDIHPAAKIGRGIML--DHATGIVVGETAVIENDVILQSVTLGGTGKSGGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVG.................................................................. 255
71 -13.2003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  23  146......................................AYYLQSRSSSIFQTDIHPAARLGSGLFL--DHATGLVVGETAVVEDNVILHGVTLGGTGKSSGDRHP-KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIG.................................................................. 262
72 -12.9005b04_I mol:protein length:678 Probable translation initiation factor eIF-2B  ali model follow..  18  311.................................................HQIYKEEDVVLARSCIIKAR----TLIGAYTKVGDASVVANT---------------IIGRNCTIGSNCSIDS-AFLWEDVVIGDNCRIGKAILANSVKIGNNCSIEDGAIVAAGVIGDNTIIEKNKRLTTFESHSQGT................................... 430
73 -12.3002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  14  203..............................DKFPRFLAHIIPEDNTRILESSKVRMGASLAAGTTIMPGAS---YVNFNAGTTGACMVEG------------SSSAIVGEGSDVGGGASILGAISVGKACLLGANSVT-GIPLGDNCIVDAGIAVLEGT................................................................ 325
74 -12.3003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  15  192..................................RVRLGAYIGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTMGTLSG--------------------------NIVISVGEGCLIGANAGI-GIPLGDRNIVEAGLYITAGT................................................................ 291
75 -11.6005e3p_A mol:protein length:302 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  11  148..................................RVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGTLSG--------------------------QHVISLGKRCLLGANSGC-GIPLGDDCIIEAGLYITAGKVLFDGSLHKASTLAGSNGL............................................. 267

FFAS is supported by the NIH grant R01-GM087218-01
8 2 7 8 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.