current user: public




3kwcA
Query: 3kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMAVQSYAAPPTPWSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFNARVGAGCVVMMHVLIQDVEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNELQLast
1 -101.0003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model  100  1MGSSSSGLVPRGSHMAVQSYAAPPTPWSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFNARVGAGCVVMMHVLIQDVEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNELQ 223
2 -78.5001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  39  21....GSGCISEGAEDNVAQEENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKE............. 245
3 -73.9003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  28  1..............MSDQSGKLLTSVRTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHH-IRIGARTSVQDGSVLHITHASDY---NPGGYPLIIGDDVTIGHQAMLHG-CTIGNRVLIGMKSMIMDAIVEDEVIVAAGATV-----SPGKVLESGFVY-MGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHLAEGYDR.......... 189
4 -73.4003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  26  3....................AMSDTLRPYKNLFPGIGQRVMIDTSSVVIGDVRLADDVGIWPLVVIRGDVNY-VAIGARTNIQDGSVLHVTHKSSS---NPHGNPLIIGEDVTVGHKVMLHG-CTIGNRVLVGMGSIVLDAIIEDDVMIGAGSLV-----PQHKRLESGYLY-LGSPVKQIRPLSDAERSGLQYSANNYVKWKDDYL--SQDNHIQP...... 187
5 -72.4001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  22  1.....................SNAMIYPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVS-PTIIGDRVNVQDQCTLHQSP----------QYPLILEDDVTVGHQVILHS-CHIKKDALIGMGSIILDAEIGEGAFIGAGSLV-----SQGKKIPPNTLA-FGRPAKVIRELTAEDRKDMERIRTQYVEKGQYYKSLQK............ 173
6 -71.7003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  28  13..................PGSMREVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDK-IEVGEGTNIQDNTVVHTDSM---------HGDTVIGKFVTIGHSCILHA-CTLGNNAFVGMGSIVMDAVMEEGSMLAAGSLL-----TRGKIVKSGELW-AGRPAKFLRMMTEEEILYLQKSAENYIALSRGY................. 184
7 -71.7001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  25  1.......................MAIYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIE-QIYVGKYSNVQDNVSIHTSH----------GYPTEIGEYVTIGHNAMVHG-AKVGNYVIIGISSVILDAKIGDHVIIGAGAVV-----PPNKEIPDYSLV-LGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHIKG.............. 169
8 -71.3003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  26  3.........................IYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGDVA-PTVIGNRVNIQDNSILHQSP----------NNPLIIEDGVTVGHQVILHS-AIVRKNALIGMGSIILDAEIGEGAFIGAGSLV-----PPGKKIPPNTLA-LGRPAKVVRELTEDDIREMERIRREYVEKGQYYKAL.............. 169
9 -54.7003TV0 Entity 1(prereleased)  ali follow..  20  1.....................GSSSMAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAG-PIVIGEGNLIEEQALIINAYPDNITPDDPEPKPMIIGTNNVFEVGCYSQA-MKMGDNNVIESKAYVGRVILTSGCIIGACCNL-----NTFEVIPENTVIY-GADCLRRVQTERPQLDFLMKILPNYHHLKKTMKGSST............ 190
10 -31.8003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  17  48..................................SIGNNVRIDDFCILSGKVTIGSYSHIAAYTALYGGEVG-IEMYDFANISSRTIVYA-------AIDDFSGNALMGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFNVVIGEGVAVGAMSMVKE-SLDDWY-------IYVGVPVRKIKARKRKIVELENEFLKSMNS...................... 199
11 -26.1003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  14  17..................................RIGAHSRIWHWVHICGGAEIGEGCSLGQNVFVGNR----VRIGNRVKIQNNVSVY---------------NVFLEDDVFCGPSMVFTNDTIVRQGATLGANCTVVGATIGRYAFVGAGAVVNK-DVPDFA-------LVVGVPARQIGWMSRHGEQ................................. 162
12 -25.0003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  18  91......................................NARIEPGALIREKVEIGDQAVIMMGAIL----NIGAVVGAGTMIDMGAVL--------------GGRATVGKHCHIGAGTVLAGPVVIENEVVIGANAVVLEGVVGEGAVVAAGAVVVE-DVPAHT-------VVAGVPAKVIKQIDDKTKSKTE.............................. 228
13 -24.6003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  88...................................KGIKARIEPGAIIRDHVEIGDNAVIMMNATI----NIGAVIGEGSMIDMNAVL--------------GGRATVGKNCHVGAGAVLAGPVIVEDDVVIGANVVVLEGVVGKGAVVAAGAVVTE-DVPPYT-------VVAGTPARVIKEIDEKTKA................................. 225
14 -24.1002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  21  81...................................IHKSALISPSAI----VEENAGILIMPYVVINAK----AKIEKGVILNTSSVI--------------EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLLADDSILGGGATLV-------KNQDEKGVF-VGVPAKRMEGGS...................................... 201
15 -23.5003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  20  269..................................GSASGASVSGYAVIKGDTVIGENVLVSQRAYLD-----NAWMGKGSNAQENCYIINS---------------RLERNCVTAHGGKIIN-AHLGDMIFTGFNSFLQGSKIGDGCVVMPHTIIDLEEPLE---IPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEVTMGRMTFRGKGGP--LDSFKKRIK 437
16 -22.7003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  22  82...................................IHKSALISPSAI----VEENAGILIMPYVVINAK----AKIEKGVILNTSSVI--------------EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLLADDSILGGGATLV-------KNQDEKGVF-VGVPAKRM.......................................... 198
17 -22.3003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  17  78..............................................IFRGDVRIHKNSKI--KGDIVATKGSKVIIGRRTTIGAGFEVVTDKC-----------NVTIGHDCMIARDVILHPDIIISSYVWVGRNVSIMGVSVGSGSVIGYGSIVTK-DVPSM-------CAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHAKLTQLE.......... 246
18 -22.1003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  18  38..................................EINQSLDEAERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVM-------------DGAPITIGDHVLIGPSTQFY-PIVIEDDVWIGGNVVINQGVIGARSVVAANSVVNQ-DVPPD-------TLVGGTPARILRSLKDPAESMAE.............................. 195
19 -21.9003fs8_A mol:protein length:273 QdtC  ali model follow..  15  73...................................IGENALIRTENVIYGDTIIGDNFQTGHKVTIRENIGNNVKIGTLSDIQHHVYIG--NYVNIHSNVFVGEKSIIKDFVWLFPHVVLTNGVTIELFAVIAARSVVLGIHINEDALVGAGAVVTK-DVPKET-------VVVGNPAREICSIRKIKNKITGEQVYPWRYTFKRGMPWEET........... 252
20 -21.1003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  15  24..........................YSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVINQQLLTKTVIGDHNIFREYSNIHKGTKEDSPTVIGNGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQCFVGDYSMVAGLAKVVQ-DVPPYSTVDGNPSTVVGLNSVGMKRAGFSPEVRNAIKHAYKVIYHSGISTRKALDELEASGNLIE 239
21 -21.0003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  12  28..........................YAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVKEEQKSGVVIGKNATIREFATINIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQVKVGEGCMIAGASALSQ-DIVPFCLAEGNRASIRSLNLVGIRRFDKDEVDRLSRA............................ 217
22 -20.9001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  17  45..........................................EKRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTI-------------DDYTVTIGDNVLIAPNVTLS-PITIGNNVWIGSHVVINPGVIGDNSVIGAGSIVTK-DIPPN-------VVAAGVPCRVIREINDRDKHYYFKDYKVESSV..................... 203
23 -20.7003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  18  46..........................................EKREDILRQLFGSVGKQINVEQNIRCDYGYNIHVGENFFANYDCIF-------------DVCKIEIGDNVMLAPNVQIYTPVKIGDNVWIGGGVIITPGIIGDNVVIGAGSVVTK-DIPPN-------TVAVGNPCRVIKKIEE..................................... 188
24 -20.6002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  14  80...................................................LQIQAKTTMGNGEITIAEKGK-ISIGKDCMLAHGYEIHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVL------------------------YKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFYK................ 215
25 -20.6003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  14  47..........................................NKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYF-------------DGGQITIGDNVFIGPNCGFY-PIHIGSNTWFGGHVAVLPGVIGEGSVIGAGSVVTK-DIPPH-------SLAVGNPCKVVRKIDNDLPSETLNDET.......................... 200
26 -20.3003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  18  56...............................................LLGSS---ADGKAQINPDFRCDYGYNIHVGKSFFANFNCVI-------------DVCEVRIGDHCMFAPGVHIYTPVKIGNNVWVGGGAIINPGVIGDNAVIASGAVVTK-DVPNN-------VVVGGNPAKVIKTIEE..................................... 190
27 -20.1002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  16  44..........................................DKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVI-------------DVCEVRIGDHCFIGPGVHIYTPVVIGHNVWIGGRAVINPGVIGDNAVIASGAVVTK-DVPAN-------AVVGGNPAKVIKWLK...................................... 185
28 -19.7003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  16  142...................................AAGGFRVVPPAIARRGSFIAKNVVL-----MPSYTNIGAYVDEGTMVDTWATV--------------GSCAQIGKNVHLSGGVGIGGPVIIEDNCFIGARSEVVEGVVEENSVISMGVYLGQ-STKIYD-------RETGEVTYGRIPAGSVVVAGNLPAKDGTHSLYCAVKVDAKTRAKVGLNELLR 314
29 -19.7001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  16  53.....................................................FGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVM-------------DVCPIRIGDNCMLAPGVHIYTPVTIGNNVWIGGRAVINPGVIGDNVVVASGAVVTK-DVPDN-------VVVGGNPARIIKKL....................................... 182
30 -19.4001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  17  25..........................FCVIGDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVLGTQEYSELIIGEDNLIREFCMINIGDKNLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQVRIAKGCMIAGKSALGK-DVPPYCTVEGNRAFIRGLNRHRMRQLESKDIDFIYAL............................ 213
31 -19.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  19  39..................................EIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIGEVEPTRVEIGDRNRIRESVTIHVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQCIIGAHVMVGGCSGVAQ-DVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYP 246
32 -18.6001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  20  99...................................QKEGFRVVPPATVRQGAFIARNTVLMPSYVNIG-----AYVDEGTMVDTWATV--------------GSCAQIGKNVHLSGGVGIGGPTIIEDNCFIGARSEVVEGVVEEGSVISMGVYLGQGRVPAGSVVVSGNLPSKDGCAVIVKKVDAKTRGKVG.............................. 265
33 -18.6003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  22  101...................................QREGFRVVPPATVRKGAFIARNTVLMPSYVNIG-----AFVDEGTMVDTWATV--------------GSCAQIGKNVHLSGGVGIGGPTIIEDNCFVGARSEVVEGVVEEGSVISMGVFIGQ.................................................................. 212
34 -18.3003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  23  104...................................QKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIG-----AYVDEGTMVDTWATV--------------GSCAQIGKNVHLSGGVGIGGPTIIEDNCFIGARSEVVEGVVEEGSVISMGVYIGQ.................................................................. 215
35 -18.2001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  14  15....................................KSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVIGDGAIVAANSVVVK-DIAP-------YMLAGGNPANEIKQRFDQDT.................................. 172
36 -17.5003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  22  131.........................................IVRHSAYIAPNAILMPSFV----------NLGAYVDKGAMIDTWATV--------------GSCAQIGKNVHLSGGVGIGGPTIIEDNCFIGARSEVVEGCVREGSVLGMGVFIGK-STKIVDRA-TGEVFYGEVPPYSV.......................................... 253
37 -17.3001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  15  20....................................NPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTFPFHF-AFAGAVNGYQPAGDTLIGHEVWIGTEAMFMPGVVGHGAIIGSRALVTG-DVEP-------YAIVGGNPARTIRKRFSDGD.................................. 169
38 -17.1003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  15  22....................................NPNIIVGKHSYYSGYYHGHSFDDCVRYLHPERDDVDKLVIGSFCSIGSGAVFMMAGNQGHRSDWISTFPFFYQDNADARDGFTRSGDTIIGHDVWIGTEAMIMPGVIGHGAIIASRSVVTK-DVAP-------YEVVGSNPAKHIKFRFSDVE.................................. 170
39 -16.8002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  11  203..............................DKFPRFLAHIIPEDNTRILESSKVRMGASLAAGTTIMPGAS---YVNFNAGTTGACMVEGRISSS----------AIVGEGSDVGGGASILGAISVGKACLLGANSVT-GIPLGDNCIVDAGIAVLEGT--------KFLLKDAEELAKLNPYFNFDKEIYKGLELKGLNGLHFRQDSISGAMIVALNKKAVK 381
40 -16.7003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  181...................................VPAGVRIADTARVRLGAYIGEGTTVMHEGFVN-----------NAGTEGPGMIEGRVSAG----------VFVGKGSDLGGGCSTMGVISVGEGCLIGANAGI-GIPLGDRNIVEAGLYIT-------AGTKVALLDEQNALVKVVKARDLAGQPDLLFRRNSQNGAVECKTNKTAIELNEALHAH.. 346
41 -15.6003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  12  158...................................VPTGVRIADADRVRLGAHLAPGTTVMHEGFVN-----------NAGTLGASMVEGRISAG----------VVVGDGSDVGGGASIMGVISIGKRCLLGANSGL-GISLGDDCVVEAGLYVT-------AGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGALNEDLHANGVPRGLE 326
42 -15.6003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  21  281..................................TIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTSSIGDGAAVGPFTYLRPGTAL---GADGKLGAFVEVKNSTIGTGTKVPHLTYV-GDADIGEYSNIGASSVFVNTTVGSHVRTGSDTFVAPVTIGDGAYTGAGTVVREDVPPGAL.......................................... 449
43 -15.6001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  18  129........................................YLQNQISVAFDVDIHPAAKIGHGIMF--DHATGIVVGETSVIENDSILQGVTLGGTGKESGDRHP-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQDKAAKPAFDMNQYFIGIDDGMNLNEGGS..................................... 272
44 -15.3001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  21  127........................................YLQNQISVAFDVDIHPAAKIGHGIMF--DHATGIVVGETSVIENDSILQGVTLGGTGKESGDRHP-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQD................................................................ 243
45 -15.3003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  16  159..............................GARSVIGEGGWLAPRVTLYHDVTIGARVSIQSGAVIGGEIGDDVEIGANTTIDRGALSDTLIGNGVKLDN--AHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVGIEICDNVFVTGMTMVT-------RSITEPGSYSSGTAMQPAAE--KKSAARIRQLDDMARRLQQLEKRLAAVTSSGDASSD.. 365
46 -15.1003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  22  148........................................YLQSRSSSIFQTDIHPAARLGSGLFL--DHATGLVVGETAVVEDNSILHGVTLGGTGKSSGDRHP-KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIGET................................................................ 264
47 -15.1003eh0_A mol:protein length:341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  19  143..............................GKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADIGDRVEIGACTTIDRGALDDTIIGNGVIIDN--AHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGMEICDKVTVTGMGMVM-------RPITEPGVYSSGIPLQPNKV........................................ 312
48 -15.1003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  20  134........................................YLQNQVSVAFGVDIHPAATIGCGIML--DHATGIVIGETAVVENDSILQSVTLGGTGKTSGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKP................................................................ 250
49 -15.0001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  22  270..................................EIAPEVQIEANVILKGQTKIGAETVLTNGTYVVSSVADGVTVGPYAHIRPNSSL---GAQVHIGNFVEVKGSSIGENTKAGHLTYI-GNCEVGSNVNFGAGTITVNTVIGDNVFVGSNSIIAPVELGDNSLVGAGSTITKDVPADAI.......................................... 438
50 -15.0001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  19  141........................................FLQNQVSVTFQVDIHPAAKIGRGIML--DHATGIVVGETAVIENDSILQSVTLGGTGKSGGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGKP................................................................ 257
51 -14.9001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  21  267..................................EIASEVQIEANVTLKGQTKIGAETVLTNGTYVVSSVADGVIVGPYAHIRPNSSL---GAQVHIGNFVEVKGSSIGENTKAGHLTYI-GNCEVGSNVNFGAGTITVNTVIGNNVFVGSNSIIAPVELGDNSLVGAGSTITKDVPADAI.......................................... 435
52 -14.9002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  20  267..................................EHGKDVEIDVNVIIEGNVKLGDRVKIGTGCVLKSIVGEKAAIGPFSRLRPGAEL---AAETHVGNFVEIKKSTVGKGSKVNHLTYV-GDSEIGSNCNIGAGVITCNTIIGDDVFVGSDTLVAPVKVANGATIGAGTTITRDVGENEL.......................................... 436
53 -14.9001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  20  267..................................THGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKANLAAACTIGPFARLRPGAEL---LEGAHVGNFVEMKKARLGKGSKAGHLTYL-GDAEIGDNVNIGAGTITCNTIIGDDVFVGSDTLVAPVTVGKGATIAAGTTVTRNVGENAL.......................................... 436
54 -14.8003fww_A mol:protein length:456 Bifunctional protein glmU  ali model follow..  19  267..................................THGRDITIDTNVIIEGHVILGDRVRIGTGCVLKARLDANCTVGPFARLRPGAEL---AEGAHVGNFVEIKKARLGKGSKAGHLSYL-GDAEIGAGVNIGAGTITCNTIIGDDVFVGSDTLVAPVTVANGATIGAGTTVTRDVAENEL.......................................... 436
55 -14.5002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  16  164..............................GAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCIEDDVEIGANTTIDRGRFKHSVVREGSKIDN--AHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGICIADHVIMMAQTGVTK-SITSPGIY-------GGAPARPYQE---------HRQVAKVRNLPRLEERIAALKLVQKLEALSE 366
56 -14.4002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  18  228..................................FSQNLGNVEDNVKIKGKVIIEEDAEIKSGTYIEGPIGKGSEIGPNSYLRPYTIL----EKNKIGASVEVKESVIMEGSKIPHLSYV-GDSVIAEDVNFGAGTLIANAFIGGHVRTGINVILPGVKIGAYARIYPGAVVNRDVGYGEF.......................................... 398
57 -13.8003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  16  155........................................EMMESVHSYTSIDIHPGASIKGHFFI--DHGVGVVIGETAIIGEWCRIY--------------------QSVTLGAMHF-H---TVGDYVTIGTGAKVLNIIVGSHVRIGANCWIDR-DVDSNQTV-----YISEHPTHFVKPCTTKG................................... 285
58 -12.6003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  16  180........................................FITEMAHSETGIDIHPGAQIGHHFTI--DHGTGVVIGATSIIGNNVKLYVTLGAKSFPLDNNGNPIKGIPR----H--------ILEDDVIVYSNATILRVTIGKGATVGGNIWVTE-NVPAGSRI-------VQRKNKDELE........................................ 304
59 -11.3002f9c_A mol:protein length:334 Hypothetical protein YDCK  ali model follow..  14  209..................................KVYGHARVIAGTEEDAIPTLRYSSQVAEHALIEGN----CVLKHHVLVGGHAEVR-------------GGPILLDDRVLIEGHACIQGEILIERQVEISGRAAVIAFDDNTIHLRGPKVINGEDRITRTPLV......................................................... 323

FFAS is supported by the NIH grant R01-GM087218-01
6 1 9 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab

Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Reed JC, Doctor KS, Godzik A. The domains of apoptosis: a genomics perspective. Sci STKE. 2004 Jun 22;2004(239):re9. Review.