current user: public




3ku8A
Query: 3ku8_A mol:protein length:156 DNA gyrase subunit A, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLast
1 -95.8003ku8_A mol:protein length:156 DNA gyrase subunit A  ali model  100  1MGSSSSGLVPRGSHMTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADR 150
2 -94.4003kua_A mol:protein length:153 DNA gyrase (Type II topoisomerase), subunit A  ali model follow..  80  1MGSSSSGLVPRGSHMTRRTIFELRKARDRAHILEGLALALANIDEIIELIKNAPTPAEAKEGLISRGWDLGNVASMLERAGTDAARPDWLEPEFGIREGKYFLTEQQAQAILELRLHRLTGLEHEKILDEYKALLDEIAELMHILAS... 147
3 -62.0003lpx_A mol:protein length:500 DNA gyrase, A subunit  ali model follow..  61  319.EMLEAFVLHRREVVTRRTIFELRKARDRAHILEGLSIALANIDPIIEMIKNSNNRKESEEKLISQGWELGNVANMLSEAGNDAARPEWLEPEYGIRDGLYYLTAEQAKAIVDLQLYKLSGMEHDKILSEYKALLDLIAELMHILATPAR 467
4 -61.6003nuh_A mol:protein length:525 DNA gyrase subunit A  ali model follow..  91  349.DIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADR 497
5 -48.7003ifz_A mol:protein length:508 DNA gyrase subunit A  ali model follow..  36  360.QLIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKALDALDEVIALIRASETVDIARAGLIEL----------------------------------LDIDEIQAQAILDMQLRRLAALERQRIIDDLAKIEAEIADLEDILAKPER 474
6 -47.9002xco_A mol:protein length:726 DNA GYRASE SUBUNIT B, DNA GYRASE SUBUNIT A  ali model follow..  46  585.EALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQR----------------------------------FKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEV 699
7 -47.5002xcs_B mol:protein length:692 DNA GYRASE SUBUNIT B, DNA GYRASE SUBUNIT A  ali model follow..  46  551.EALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESLQQR----------------------------------FKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEV 665
8 -47.4003RAD Entity 1(prereleased)  ali follow..  35  344.PILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKADAKENLKVS----------------------------------YDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERT 458
9 -47.4002nov_A mol:protein length:496 DNA topoisomerase 4 subunit A  ali model follow..  35  344.PILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKADAKENLKVS----------------------------------YDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERT 458
10 -47.0002inr_A mol:protein length:514 DNA topoisomerase 4 subunit A  ali model follow..  39  362.QIIDSYLNHQIEVVANRTKFELDNAEKRMHIVEGLIKALSILDKVIELIRSSKNKRDAKENLIEV----------------------------------YEFTEEQAEAIVMLQLYRLTNTDIVALEGEHKELEALIKQLRHILDNHDA 476
11 -42.4002xkj_E mol:protein length:767 TOPOISOMERASE IV  ali model follow..  30  613.RILLEWIEIRKKTVTRRLQYHLNRIEKRLHILAGLLIAYLDIDTVIRIIREE---DQPKPVLMEH----------------------------------FNIDEIQAEAILELKLRHLAKLEEMEIRHEQDELSAKAAIIREQLENPES 724
12 -35.0001zvu_A mol:protein length:716 Topoisomerase IV subunit A  ali model follow..  42  319.EILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEP---KPALMSR----------------------------------FGLTETQAEAILELKLRHLAKLEEMKIRGEQSELEKERDQLQGILASERK 430
13 -25.3003qx3_A mol:protein length:803 DNA topoisomerase 2-beta  ali model follow..  17  615.DILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQAFILEKIQGKI--TIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSD.. 760
14 -21.2001bgw_A mol:protein length:793 TOPOISOMERASE  ali model follow..  16  584.EILSEFYYVRLEYYQKRKDHEVEKYSFQVKFIKMLTVTNKPRNAIIQELENLGFPRFNKEGKPYYGSPNDEIAEQINDVKGATSDEEDEESSHEDTENGPEELYGTYEYLLGMRIWSLTKERYQKLLKQKQEKETELENLLKLSAKD.. 745

FFAS is supported by the NIH grant R01-GM087218-01
6 0 4 6 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.