current user: public




Query: 3jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MLRLKTQDSRLKTQDSRLKTQDSRLKTQDSFSVDDNGSGNVFVCGDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKGDIVATKGSKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHAKLTQLELast
1 -85.8003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model  100  1MLRLKTQDSRLKTQDSRLKTQDSRLKTQDSFSVDDNGSGNVFVCGDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKGDIVATKGSKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHAKLTQLE 246
2 -63.3002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  30  7.................................SEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKENCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFYK...... 215
3 -60.2003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  22  1...............SNAMTEKEKMLAEKWYDANFD--------QYLINERARAKDICFELNHTRPSATNKRKELIDQLFQT-----TTDNVSISIPFDTDYGWNVKLGKNVYVNTNC-YFMDGGQITIGDNVFIGPNCGFYTA-THPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIK.............. 202
4 -60.1004egg_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  22  1..................MTEKEKMLAEKWYDANFD--------QTLINERLRAKVICFALNHTNPVATMMRKVLIDALFQT-----TTDNVSISIPFDTDYGWNVKLGKNVYVNTNC-YFMDGGQITIGDNVFIGPNCGFYTA-THPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIKLE............ 201
5 -60.1004dcl_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  22  1..................MTEKEKMLAEKWYDANFD--------QTLINERLRAKVICFALNHTNPSATLKRKVLIDALFQT-----TTDNVSISIPFDTDYGWNVKLGKNVYVNTNC-YFMDGGQITIGDNVFIGPNCGFYTA-THPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIKLE............ 201
6 -59.4001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  26  3..................MPMTERIRAGKLFTDMCE---------GLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFAT-----VGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIV-DDYTVTIGDNVLIAPNVTLSVT-GHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESS............ 202
7 -59.3003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  25  1...............SNAMTEKEKMLSGKGYYANDE---------LLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGS-----VGKQINVEQNIRCDYGYNIHVGENFFANYDC-IFLDVCKIEIGDNVMLAPNVQIYTA-YHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRVIKKIEE........................... 188
8 -59.1002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  25  1.................MKSEKEKMLAGHLYNPADL---------ELVKERERARRLVRLYNETLETEYDKRTGLLKELFGS-----TGERLFIEPNFRCDYGYNIHVGENFFMNFDG-VILDVCEVRIGDHCFIGPGVHIYTA-THPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKW.............................. 183
9 -58.5003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  27  1..............SNAMKTEKDKMLAGEMYIADDE---------ELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSSA----DGKAQINPDFRCDYGYNIHVGKSFFANFNC-VILDVCEVRIGDHCMFAPGVHIYTA-THPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIEE........................... 190
10 -58.0003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  22  1.............SNAMKMSELEKMLKGEHFDGASA---------EIEALRSQAGRLKLEINQS--LDEAERYALQRELFGH-----LGHKSCVQPPFHCEFGKTIRIGDHTFINMNV-VMLDGAPITIGDHVLIGPSTQFYTA-SHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKDPAESMAE.................... 195
11 -57.6001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  25  1..................STEKEKMIAGELYRSADE---------TLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVT------EAYIEPTFRCDYGYNIFLGNNFFANFDC-VMLDVCPIRIGDNCMLAPGVHIYTA-THPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKK.............................. 181
12 -36.6003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  18  43.................................................................................NPGVISIGNNVRIDDFCIL--SGKVTIGSYSHIAAYTALYGGEVGIEMYDFANISSRTIVYAAIDDFSGNALMGPTIPKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRKIKARKRKIVELENEFLKSMNS............ 199
13 -29.8001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  27  19.....................................................................................................SNPNIRVGRYSYYSYLMPDRDDVDKLVIGSFCSIGSGAAMAGNQGHRAEWASTVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTIRK.............................. 163
14 -29.8003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  30  21.....................................................................................................TNPNIIVGKHSYYSYLHPERDDVDKLVIGSFCSIGSGAVMAGNQGHRSDWISTRDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHIKF.............................. 164
15 -29.3001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  29  23..................................................................................................ILEKLENVEVGEYSYYDSKNGETFDKQKLKIGKFCSIGPGVTIMNGANHRMDGSTKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQ.............................. 166
16 -29.1004hur_A mol:protein length:220 Virginiamycin A acetyltransferase  ali model follow..  27  32.....................................................................................................TNENILVGEYSYYDSKRGESFEDQKLIIGRFCSIGPGTTIMNGANHRMDGSTSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVAPYSIVGGNPLKFIRK.............................. 172
17 -25.1003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  21  7.................................................................................KGKTPQIAASAFIADYVTI---GDVVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSPNNPLI----EDGVTVGHQVIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYYKALQQ.. 171
18 -25.0003fs8_A mol:protein length:273 QdtC  ali model follow..  25  107.....................................................................................TKIGNNVKIGTLSDIQHH--VYIGNYVNIHSNVFV---GEKSIIKDFVWLFPHVVL-TNDPTP--------PSNELLGVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREICS.............................. 223
19 -25.0001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  22  30........................................................................................................DVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQYPLI----EDDVTVGHQVHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYYKSLQK.. 173
20 -24.5004mfg_A mol:protein length:168 Putative acyltransferase  ali model follow..  20  30........................................................................................................NVKIGKDSSIWYNAVVRGDEGPITIGENTNIQDCSIVHGDTETIIGNNVTVGHRSIVHGCKISDNVLIGMGSIILDNAEIGEYTLIGAGTLITKKFPPGVLIMGSPGKVVRELTEEDKKYIDESYEWYLEAAQNQK...... 167
21 -24.2004m9c_A mol:protein length:216 Bacterial transferase hexapeptide (Three repe  ali model follow..  26  101..................................................................................LDEVEIGEGSLLCPFTCL--TSNIKIGKFFHANIYSYVAHD---CVIGDYVTFAPGAKC-------------------NGNIHIEDHAYIGTGAVIKQGLIIGKGAIVGMGAVVTKSVPAGVTVVGNPARILERK............................. 216
22 -24.0001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  18  28........................................................................................................DVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPTE----GEYVTIGHNAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHIK..... 168
23 -23.8002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  13  55...............................................................IAIGNNEIRKKIYQKISENGFKIV----NLIHKSALISPSAIVEENAGILIMPYVVI---NAKAKIEKGVILNTSSVI-EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKRMEGG............................. 200
24 -23.5004ea7_A mol:protein length:220 Perosamine N-acetyltransferase  ali model follow..  24  109..................................................................................SPSVRLGEGVAVMAGVAI--NADSWIGDLAIINTGAVVDHD---CRLGAACHLGPASAL-------------------AGGVSVGERAFLGVGARVIPGVTIGADTIVGAGGVVVRDLPDSVLAIGVPAKIKGD.............................. 218
25 -23.5005adx_V mol:protein length:165 DYNACTIN SUBUNIT 6  ali model follow..  17  1.........................................................................................SGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPSKGVAFFPLHIGDHVFIEEDCVIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPEVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV.... 165
26 -23.4004n27_A mol:protein length:195 Bacterial transferase hexapeptide repeat  ali model follow..  18  44........................................................................................................KVVVGENAGFWFGAVLRGDNEPITIGADTNVQEQTIMHTDIGFPLT----GAGCTIGHRATIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKMEIPDNSLVVGSPARVLRQLDDAAVEKLRASAKHYVERGHSFMR..... 184
27 -23.3003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  30  104.....................................................................................VEIGDNAVIMMNATINIGA--VIGEGSMIDMNAVL---GGRATVGKNCHVGAGAVL----AGVIEPPS-------AKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKAK...................... 226
28 -23.1003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  30  104.....................................................................................VEIGDQAVIMMGAILNIGA--VVGAGTMIDMGAVL---GGRATVGKHCHIGAGTVL----AGVIEPPS-------AAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDDKTKSK...................... 226
29 -22.8003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  13  56...............................................................IAIGNNEIRKKIYQKISENGFKIV----NLIHKSALISPSAIVEENAGILIMPYVVI---NAKAKIEKGVILNTSSVI-EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKRM................................ 198
30 -22.6004m98_A mol:protein length:208 Pilin glycosylation protein  ali model follow..  21  101..................................................................................SPSAIIGQGSVVMAKAVV--QAGSVLKDGVIVNTAATVDHD---CLLDAFVHISPGAHL-------------------SGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKPL................................ 208
31 -22.4003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  22  1..................................................................................GHMATIHPTAIVDEGARIGAHSRIEIGEGCSLGQNVFV---GNRVRIGNRVKIQNNVSVYDN-TNVYNPRAAIERKSEYRDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQI................................ 153
32 -22.1004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  27  9.............................................................QSQNIGDNTKVWQFCVILAG----AVIGRNCNICANSLI--ENDVVIGDNVTIKSGVQI----DGIHIQDDVFIGPNV-TFTNDKQP----RSKIYPDEYLKTIVKKGASIGANSTILPGILIGENAMVGAGAVITKNVPDNAIVIGNPGRIT................................ 147
33 -21.9003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  19  29......................................................................................SVDSTAFIAGNARI---GDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTDSMHGDTVIGKFVTIGHSCILTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGY....... 184
34 -21.1003tio_A mol:protein length:183 Protein YrdA  ali model follow..  18  13......................................................................................QIGQRVMIDDSSVV---GDVRLADDVGIWPLVVIRGDVHYVQIGARTNIQDGSMLHVT--HKSSYNPDGNPLTIGEDVTVGNRVLVGMGSILLDGAIVEDDVMIGAGSLVPKRLESGYLYLGSPVKQIRPLSDEEKAGLRYSANNYVKWKDEYLDQGN.. 179
35 -20.9003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  16  21......................................................................................KLGERVFVDRSSVI---GDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGSVLHIT--HASDYNPGGYPLIIGDDVTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSKVLESGFVYMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHLAEGYDR 189
36 -20.8003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  18  17......................................................................................GIGQRVMIDTSSVV---GDVRLADDVGIWPLVVIRGDVNYVAIGARTNIQDGSVLHVT--HKSSSNPHGNPLIIGEDVTVGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPKRLESGYLYLGSPVKQIRPLSDAERSGLQYSANNYVKWKDDYLSQDN.. 183
37 -20.7004n69_A mol:protein length:286 Serine Acetyltransferase Apoenzyme  ali model follow..  32  153.....................................................................................VDIHPAARIGKGILFDHATGVVVGETAVIGNNVSILHH---VTLG-------GTGKVGGDRHP----------------KIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVPPRTTAVGNPARLV................................ 255
38 -20.6003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  28  159.....................................................................................TDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHG---VTLG-------GTGKSSGDRHP----------------KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARII................................ 261
39 -20.6004hzd_A mol:protein length:282 CysE, serine acetyltransferase  ali model follow..  28  152.....................................................................................TDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHG---VTLG-------GTGKSSGDRHP----------------KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARII................................ 254
40 -20.5001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  33  152.....................................................................................VDIHPAAKIGRGIMLDHATGIVVGETAVIENDVSILQS---VTLG-------GTGKSGGDRHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIV................................ 254
41 -20.4003tv0_A mol:protein length:194 Dynactin subunit 6  ali model follow..  16  9.................................................................................TQKSVKIAPGAVVCVESEI---GDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPD---NITPDTEDPEPKPMIIGTNN-IESKAYVGRNVILTSGCIIGACCNLNEVIPENTVIYGADCL.................................. 153
42 -20.4005afu_U mol:protein length:168 DYNACTIN  ali model follow..  14  14........................................................................................................DVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINPDTEKPMIIGTNNVFEVGCYSKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNEVIPENTVIYGADCLRRVQTERPQPTLQLDFLMKILPNYHHLKKTMKGS 167
43 -20.4005adx_U mol:protein length:190 DYNACTIN 5  ali model follow..  16  5.................................................................................TQKSVKIAPGAVVCVESEIR--GDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPD---NITPDAEDSEPKPMIIGTNN-IESKAYVGRNVILTSGCIIGACCNLNEVIPENTVIYGADCLRRVQ.............................. 153
44 -20.3003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  32  145.....................................................................................VDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQS---VTLG-------GTGKTSGDRHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIV................................ 247
45 -20.3001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  30  140.....................................................................................VDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQG---VTLG-------GTGKESGDRHP----------------KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIV................................ 242
46 -20.2004h7o_A mol:protein length:281 Serine acetyltransferase  ali model follow..  32  142.....................................................................................VDIHPAARIGRGIMLDHATGIVIGETAVVEDDVSILQD---VTLG-------GTGKECGDRHP----------------KIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIV................................ 244
47 -20.2001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  30  138.....................................................................................VDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQG---VTLG-------GTGKESGDRHP----------------KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIV................................ 240
48 -18.7003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  21  47.............................................................................NLIGD---VRIKDYVHIGTSIRADEGTPFHIGSRTNIQDGVVI--QEYSVWIGDNVSITHMALI-----HG--------------PAYIGDGCFIGFRSTVF-NARVGAGCVVMMHVLIQEIPPGKYVPSGMVITTQQQ.............................. 177
49 -17.9004r36_A mol:protein length:275 Putative acyl-[acyl-carrier-protein]--UDP-N-a  ali model follow..  24  65..........................................................GNGNTIFPGAVIGAIPQDLKFKGEESTAEIGDNNLIRENVTINRGTRTIVGNNNLLMEGVHVAHD---ALIGNGCIVGNSTKM-------------------AGEIIIDDNAIISANVLMHQFCRVGGYVMIQGGCRFSKDIPPYIIAGREPIAYSGINIIGLRRR...................... 212
50 -17.9001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  26  53..........................................................GKNTEIFPFAVLGTQPQDLKYKGEYSELIIGEDNLIREFCMINPGTETLIGDKNLLMAYVHVAHD---CVIGSHCILANGVTL---AGH----------------IEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFIRGLNRHRMRQLLES................... 204
51 -17.4005dem_A mol:protein length:258 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  22  53..........................................................GKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTETTIGDHNLIMAYAHIGHD---SVIGNHCILVNNTAL---AGH----------------VHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRR...................... 201
52 -17.3003t57_A mol:protein length:305 UDP-N-acetylglucosamine O-acyltransferase dom  ali model follow..  23  59....................................GESCVLMTGAVVGDELPGYTFIGCNNIIGHHAVVGVKCQDLKYKGDECFLCIGNNNEIREFCSIHRSSKTVIGDNNLIMGSCHIAHD---CKIGDRNIFANNTLL---AGH----------------VVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRN...................... 229
53 -17.2004eqy_A mol:protein length:283 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  20  68..........................................................GEDNRIGHYASVGGRPQDMKYKDEPTRLVIGDRNTIREFTTIHTGTVTTLGDDNWIMAYVHIGHD---CRVGSHVVLSSNAQM---AGH----------------VEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIPPFVIAAGNKAEPHGINVEGLRRR...................... 216
54 -17.1004e6t_A mol:protein length:294 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  26  82..........................................................GQNNEIFQFASVGEVCQDLKYKGEETWLEIGNNNLIREHCSLHRGTLTKIGSHNLLMVNTHIAHD---CIVGDHNIFANNVGV---AGH----------------VHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVPAYVMASGNPAHAFGINIEGMRRK...................... 230
55 -17.1002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  20  59..........................................................GRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTLTKVGSDNLLMINAHIAHD---CTVGNRCILANNATL---AGH----------------VSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRR...................... 207
56 -16.5001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  14  61......................................................................................VIDPTAYIDPQASV---GEVTIGANVMVSPMASIRSDGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVGRYIPAGMVVTSQEADKLPEVTDDYAY....................... 225
57 -16.4003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  23  56..........................................................GDHSRVFSYAIVGDIPQDISYKEEQSGVVIGKNATIREFATINSGTATRIGDNAFIMAYCHIAHD---CLLGNNIILANNATL---AGH----------------VELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRRFDK................... 208
58 -16.0003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  17  52..........................................................GKFNRFHQGAVIGVMPQDLGFNQQLTKTVIGDHNIFREYSNIHKGTPTVIGNKNYFMGNSHVGHD---CILGNNNILTHGAVL---AGH----------------VTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVVGLNSVGMKRA...................... 200
59 -15.8003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  20  134.....................................................AVIVYRIAHVLYECGERYYCREMMESVHSYTSIDIHPGASIKGHFFIDHGVGVVIGETAIIGEWCRIY---QSVTLGAMHF-EGGVIKRGTKRHPT----------------VGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQVYISEHPTHFVKPCTTKGMKNDTEIIAIIPSSPLANSPSILE 309
60 -15.7003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  21  167.............................................................HELLILGVPLIPRFITEMAHSETGIDIHPGAQIGHHFTIDHGTGVVIGATSIIGNNVKLY---QGVTLGAKSF-NNGNPIKGIPRHPI----------------LEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSIVQRKNKDELE............................... 304
61 -13.3002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  25  239............................................................................VKIKGKEEDAEIKSGTYIEGPVYIGKGSEIILVEKNKIGASVEVIMEGSKIVIAEDVNFGAGTLILRFDEKEVKVNVKGKRISSGRRAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFFK....................................... 400
62 -12.4002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  19  164..................................................................................GAYSTVGEHSYIHPRVVIRER--VSIGKRVIIQPGAVIGSCGGKVIIEDDVEIGANTTIDRGRAHQVEVGQHSAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQE---IHRQVVRNLPRLEERIAALEKLVQKLE 362
63 -11.8001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  18  238VMRRRINHKHMVNGVSFVNPEATYIDIDVEIASEVQIEANVTLKGQTKIGAETVLTNGTYVVDSTIGAGAVITNSMIEESSVADGVIVGPYAHIRPNSSLGAQVHISIGENTKAGHLTYI----GNCEVGSNVNFGAGTITVNYDG------------KNKYKTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKDE............................. 447
64 -11.7001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  18  241VMRRRINHKHMVNGVSFVNPEATYIDIDVEIAPEVQIEANVILKGQTKIGAETVLTNGTYVVDSTIGAGAVITNSMIEESSVADGVTVGPYAHIRPNSSLGAQVHISIGENTKAGHLTYI----GNCEVGSNVNFGAGTITVNYDG------------KNKYKTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKDE............................. 450
65 -11.6001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  16  158...ATDEQRQIQEINTGILIANGADMKRWLAKLTNNNAQGEYYITDIIALAYQAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVII---EGNVTLGHRVKIGTGCVIKNSVGH-LGDAEIGDNVNIGAGTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKEG--WRRPVKKK................... 456
66 -11.6004fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  16  161...ASDAQREINEINTGILVANGRDLKRWLSLLDNNNAQGEFYITDIIALAHATVHPTRLSEVEGVNNRLQLSALERVFQTEQAEKLLLAGVMLLDPSRFDLRGELTHGRDITIDTNVII---EGHVILGDRVRIGTGCVLKNCVGH-LGDAEIGAGVNIGAGTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVHIQG--WKRPVKKK................... 459
67 -11.5002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  17  158...ANAEQLNIKEVNTGVMVSDGASFKKWLARVGNNNAQGEYYLTDLIALANQAVQATDVMEVEGANNRLQLAALERYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVII---EGNVKLGDRVKIGTGCVLKNVVNH-VGDSEIGSNCNIGAGVIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELVITRVAQRHIQG--WQRPIKKK................... 456
68 -11.3004e75_A mol:protein length:357 UDP-3-O-acylglucosamine N-acyltransferase  ali model follow..  17  148..................................................................................DDNVEVGKDCFIDSYVTITGS--SKLRDRVRIHSSTVIGGEGGSVLIGNDVRIGSNCSI---DRGALDNTILEDGVIIDNLVQIAHNVHIGSNTAIIAGLSIADNVTLTGMSMVTKNIEAGTYSSGTGLFENNH---WKKTIVRLRQLADVPLTQITKRLDHIQ 344
69 -11.2003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  16  315...............................................................VAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLTIGTGTKVPHLTYV----GDADIGEYSNIGASSVFVNYDG------------TSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASE......... 481
70 -10.5003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  160.......................................................................................IAKNVVLMPSYT---NIGAYVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGI----GGVLEPLQ-------ANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTAGSVVVAGN-AVIVKKVDAKTRAKVG.................... 308
71 -10.5004ihf_A mol:protein length:348 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acy  ali model follow..  20  126..................................................................................ESGVELGDNVIIGAGCFV--GKNSKIGAGSRLWANVTIYHE---IQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGCQIAANVVIGDNTAVSLKIGRYCMIGG...................................... 270
72 -10.4005b04_I mol:protein length:678 Probable translation initiation factor eIF-2B  ali model follow..  19  309.................................................................................QRHQIYKEEDVVLARSCII--KARTLIGAYTKVGDASVV----ANTIIGRNCTIGSNCSIDSAFLWEDVVIGDNCRIGKA---ILANSVKIGNNCSIEDGAIVAAGVVIGDNTIIEKNKRLTTFESHSQGTLNDPSLVGIGGRGQEYHAEEDSDDE......... 455
73 -10.2003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  19  141..................................................................................ESGARIGAGVSIGAHCVI--GARSVIGEGGWLAPRVTLYHD---VTIGARVSIQSGAVIGGEGFGFANEKGVWQKIAQIGGVTIGDDVEIGANTTIDRGIMIAHNVQIGDHTAMSAKIGRHCMLAG...................................... 285
74 -10.1003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  14  276.......................................................................................VSGYAVIKGDTVIGENVLVWMGKGSNAQENCYIINS----RLERNCVTAHGGKIINA--------------------HLGDMIFTGFNSFLQGSLKIGDGCVVMPHTIIDLEIPAGHLVWGEFAKVDGE.............................. 413
75 -9.8903eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  138.......................................................................................IAPNAILMPSFV---NLGAYVDKGAMIDTWATV---GSCAQIGKNVHLSGGVGI----GGVLEPMQ-------AGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTPYSVVVAGT-AVIVKRADEKTRSKTS.................... 291

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.