current user: public




3jqyB
Query: 3jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MLRLKTQDSRLKTQDSRLKTQDSRLKTQDSFSVDDNGSGNVFVCGDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKGDIVATKGSKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHAKLTQLELast
1 -94.4003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model  100  1MLRLKTQDSRLKTQDSRLKTQDSRLKTQDSFSVDDNGSGNVFVCGDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKGDIVATKGSKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHAKLTQLE 246
2 -74.4001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  25  1................MNMPMTERIRAGKLFTDMCE---------GLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFAT-----VGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIV-DDYTVTIGDNVLIAPNVTLSVT-GHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESSV........... 203
3 -73.2003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  22  1...............SNAMTEKEKMLAEKWYDAN--------FDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQT-----TTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFM-DGGQITIGDNVFIGPNCGFYTA-THPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIK.............. 202
4 -72.0003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  25  1...............SNAMTEKEKMLSGKGYYANDE---------LLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGS-----VGKQINVEQNIRCDYGYNIHVGENFFANYDCIFL-DVCKIEIGDNVMLAPNVQIYTA-YHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRVIKKIEE........................... 188
5 -71.9002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  25  1.................MKSEKEKMLAGHLYNPADL---------ELVKERERARRLVRLYNETLETEYDKRTGLLKELFGS-----TGERLFIEPNFRCDYGYNIHVGENFFMNFDG-VILDVCEVRIGDHCFIGPGVHIYTA-THPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWL............................. 184
6 -71.2003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  27  1..............SNAMKTEKDKMLAGEMYIADDE---------ELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSSA----DGKAQINPDFRCDYGYNIHVGKSFFANFNC-VILDVCEVRIGDHCMFAPGVHIYTA-THPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIEE........................... 190
7 -71.1003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  21  1.............SNAMKMSELEKMLKGEHFDGASA---------EIEALRSQAGRLKLEINQS--LDEAERYALQRELFGH-----LGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVML-DGAPITIGDHVLIGPSTQFYTA-SHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKDPAESMAE.................... 195
8 -69.9001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  25  1..................STEKEKMIAGELYRSADE---------TLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVT------EAYIEPTFRCDYGYNIFLGNNFFANFDC-VMLDVCPIRIGDNCMLAPGVHIYTA-THPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKKL............................. 182
9 -62.3002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  30  7.................................SEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKENCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFYK...... 215
10 -51.1003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  21  1MKMMDANEIISFIQKSEKKTPVKVYIKGDLKEVTFPETVQAFVNKKSGSEIKTILDENSKYIVDYVVENDRRNSAIPMLDLKGIKARIEPGAIIR---HVEIGDNAVIMMNATINIGAVIAVLGGRATVGKNCHVGAGAVLAGV-IEP----------PSAKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKAKTE.................... 228
11 -47.7001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  20  1........................................................MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYY------DSKNGETFDKQILYHYPI----LNDKLKIGKFCSIGPGVTIIMNGAHRMDHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIK................ 180
12 -45.8003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  16  26....................................................................................FLSVGKNVLISKKASIYNPGVISIGNNVRIDDFCILYGGEVGIEMYDFANISSRTIVYAAI-DDFSGIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRKIKARKRKIVELENEFLKSMNS............ 199
13 -44.6003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  21  25TLKGQLKEVTFPETIKVFNNCKTGTLFGDWADV-----------KPFLEANKEKIEDYVVENDARNSAIPFLDLKDINAR--REKVEIGDQAVIMMGAILNIGAV--VGAGTMIDMGAVL---GGRATVGKHCHIGAGTVLAGV-IEPPS----------AAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQIDDKTKSKT..................... 227
14 -41.6001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  24  20......................................................................................................NPNIRVGRYSYYSGYYHGRDDVDKLVIGSFCSIGSGAAFIMAGNHRAEFAGAVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTIRKRFSDGDIQNLLEMA................ 177
15 -40.2003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  27  22......................................................................................................NPNIIVGKHSYYSGYYHGRDDVDKLVIGSFCSIGSGAVFMMAQGHRSDWISTRDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHIKFRFSDVEIAMLLEMA................ 178
16 -36.2003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  23  34.....................................................................................AEIGEGCSLGQNVFV--GNRVRIGNRVKIQNNVSVYDN---VFLEDDVFCGPSMVF-TNVYNPRAAIERKSEY---RDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQIGWMSRHGEQ....................... 162
17 -34.9003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  13  57.RAELSPKAASAEIREAVAHAIEQLDRGALRVAEKIDVHQWLKKAVLLSFRLEDNAPMPAGGYSQFYDKVPSKFANYTAED-----FAAGGFRVVPPAIARRGSFIAKNVPSYTNIGAYVTMVDTWATVGSCAQIGKNVHLSGGVG-----IGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIP.............................. 271
18 -34.5002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  16  55...............................................................IAIGNNEIRKKIYQKINGFKIVNLIHKSALISPSAIVEENAGILIMPYVVINAK---------AKIEKGVILNTSSVI-EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKRMEGGS............................ 201
19 -32.9003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  16  56...............................................................IAIGNNEIRKKIYQKINGFKIVNLIHKSALISPSAIVEENAGILIMPYVVINAK---------AKIEKGVILNTSSVI-EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKRM................................ 198
20 -30.9002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  12  143.LKLYLLSTKKVPLRSINLNGAFGLLSNVAWSDDKP---------ELEYLRANEMRLKMSNQYPKIDFVDKFPRFLAHIIPE-------DNTRILESSKVRMGASLAAGTTIYVNFNAGT-TGACMVRISSSAIVGEGSDVGGG-ASILGVLSGTS----GNAISVGKACLLGANSVT--GIPLGDNCIVDAGIAVLEGTKFLLKDAEELAKLNPYFNFDKEIYKGLELKGLNGLHFRQDSIS... 368
21 -30.4003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  10  88YLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGP---------CAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYV--------VPTGVRIADADRVRLGAHLTVMHEGFVNYNAGT-LGASMVRISAGVVVGDGSDVGGG-ASIMGTLSGGG----THVISIGKRCLLGANSGL--GISLGDDCVVEAGLYVTAGTRVTMPDSNSVKA--RELSGSSNLLFRRNSVSGAVEVLARDG..... 307
22 -29.0003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  10  181.......................................................................................VPAGVRIADTARVRLGAYITVMHEGFVNFNAGT-EGPGMIEVSAGVFVGKGSDLGGG-CSTMGTLSGGG----NIVISVGEGCLIGANAGI--GIPLGDRNIVEAGLYITAGTKVALLDEQNLVKVVKA.............................. 308
23 -28.1003fs8_A mol:protein length:273 QdtC  ali model follow..  19  95.....................................................................................FQTGHKVTIRENTKI--GNNVKIGTLSDIQHHVYIVNIHSNVFVGEKSIIKDFVWL---FPHVVLTNDPTPPSNELLGVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREICSIRKIKNKITGEQVYPWRYTFKRGMPWEET. 252
24 -27.5001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  21  14......................................................................................KIASSAFIADYVTI---GDVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQYPLILEDDVTVGHQVHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYYKSLQK.. 173
25 -27.4003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  22  12......................................................................................QIAASAFIADYVTI---GDVVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSPNNPLIIEDGVTVGHQVHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYYKALQQQ. 172
26 -27.1001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  18  12......................................................................................RIHPSAFVDENAVV---GDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPTEIGEYVTIGHNAHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHIKGRKR. 172
27 -26.6003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  16  21......................................................................................KLGERVFVDRSSVI---GDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGSVLHITHASDYNPGGYPLIIGDDVTITIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSKVLESGFVYMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHLAEGYDR 189
28 -26.3003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  19  29......................................................................................SVDSTAFIAGNARI---GDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTDSMHGDTVIGKFVTIGHSCILTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGY....... 184
29 -26.2003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  18  17......................................................................................GIGQRVMIDTSSVV---GDVRLADDVGIWPLVVIRGDVNYVAIGARTNIQDGSVLHVTHKSSSNPHGNPLIIGEDVTVTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPKRLESGYLYLGSPVKQIRPLSDAERSGLQYSANNYVKWKDDYLSQDNH. 184
30 -25.2001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  29  140.....................................................................................VDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQG---VTLG-------GTGKESGDRHP----------------KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQ.............................. 244
31 -25.1001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  29  138.....................................................................................VDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQG---VTLG-------GTGKESGDRHP----------------KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQ.............................. 242
32 -25.1003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  27  159.....................................................................................TDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHG---VTLG-------GTGKSSGDRHP----------------KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIGE.............................. 263
33 -24.9003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  31  145.....................................................................................VDIHPAATIGCGIMLDHATGIVIGETAVVENDVSILQS---VTLG-------GTGKTSGDRHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGK.............................. 249
34 -24.7001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  32  152.....................................................................................VDIHPAAKIGRGIMLDHATGIVVGETAVIENDVSILQS---VTLG-------GTGKSGGDRHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGK.............................. 256
35 -24.4003TV0 Entity 1(prereleased)  ali follow..  15  9.................................................................................TQKSVKIAPGAVVCVESEIR--GDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTED---PEPKPMIIGTNN-IESKAYVGRNVILTSGCIIGACCNLNEVIPENTVIYGADCLRRVQTER........................... 160
36 -23.5003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  150......................................................................................................NLGAYVDKGAMIDTWATV---GSCAQIGKNVHLSGGVGIGGVLEPM------------AGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEPPYSV................................ 253
37 -23.2003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  22  179.........................................................................RFITEMAHSETGIDIHPGAQIGHHFTIDHGTGVVIGATSIIGNNVKLYQG---VTLGAKSF-NNGNPIKGIPRHP----------------ILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSRIVQRKNKDELE.............................. 304
38 -22.3003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  17  47.............................................................................NLIGD---VRIKDYVHIGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQSVWIGDNVSITHMALI-----HG--------------PAYIGDGCFIGFRSTVF-NARVGAGCVVMMHVLIQDEIPPGVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIA 213
39 -22.2001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  17  115.....................................................................................AFIARNTVLMPSYV---NIGAYVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGIGGV----------------ANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGECAVIVKKVDAKTRGK...................... 263
40 -22.2003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  25  154.........................................................................REMMESVHSYTSIDIHPGASIKGHFFIDHGVGVVIGETAIIGEWCRIYQS---VTLGAMHF-EGGVIKRGTKRHP----------------TVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNVYISEHPTHFVKP.............................. 280
41 -21.4003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  117.....................................................................................AFIARNTVLMPSYV---NIGAFVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGIGGV----------------ANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHY.................................. 226
42 -21.0003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  120.....................................................................................AFIARNTVLMPSYV---NIGAYVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGIGGV----------------ANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGD..................................... 226
43 -20.5001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  12  61......................................................................................VIDPTAYIDPQASV---GEVTIGANVMVSPMASIRSDGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFRYIPAGMVVTSQEADKLPEVTDDYAYSHTNEAVVYVNVHLAEG...... 242
44 -19.1001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  27  52.........................................................VGKNTEIFPFAVLGTQPQDLKYKGEYSELIIGEDNLIREFCMINPGTETLIGDKNLLMAYVHVAHD---CVIGSHCILANGVTL---AGH----------------IEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFI................................. 190
45 -19.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  20  58.........................................................IGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTLTKVGSDNLLMINAHIAHD---CTVGNRCILANNATL---AGH----------------VSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATP................................. 196
46 -17.6003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  24  55.........................................................IGDHSRVFSYAIVGDIPQDISYKEEKSGVVIGKNATIREFATINSGTATRIGDNAFIMAYCHIAHD---CLLGNNIILANNATL---AGH----------------VELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASI................................. 194
47 -17.5003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  17  51.........................................................IGKFNRFHQGAVIGVMPQDLGFNQQLTKTVIGDHNIFREYSNIHKGTKTVIGNKNYFMGNSHVGHD---CILGNNNILTHGAVL-------------------AGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTV................................. 189
48 -15.4002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  18  167.....................................................................................STVGEHSYIHPRVVIRER--VSIGKRVIIQPGAVIGSCGGKVIIEDDVEIGANTTIDRGRAHQVEVGQHSAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQEIHR-QVAKVRNLPRLEERIAALEKLVQKLE 362
49 -15.1002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  25  248..................................................................................EEDAEIKSGTYIEGPVYIGKGSEIILVEKNKIGASVEVIMEGSKIVIAEDVNFGAGTLILRFDEKEVKVNVKGKRISSGRRAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFFK....................................... 400
50 -14.1003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  15  173....TPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQL---LGRTQIGGRCVVGPDTTLTDVAPH-VGDADIGEYSNIGASSVVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASEMACQ..... 485
51 -14.0003eh0_A mol:protein length:341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  16  146.....................................................................................SKIGAGSRLWANVTIYHE--IQIGQNCLIQSGTVVGADGGRVIIGDRVEIGACTTIDRGAAHNVVIGDNTGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITPGVYSSGIPLQPNKVWRK-TAALVMNIDDMSKRLKSLERKVNQQD 341
52 -13.8003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  13  162.....................................................................................SVIGEGGWLAPRVTLYHD--VTIGARVSIQSGAVIGGEGGGVTIGDDVEIGANTTIDRGAAHNVQIGDHTACVGISGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITPGSYSSGTAMQPAAEWKK-SAARIRQLDDMARRLQQLEKRLAAVT 357
53 -13.5003fww_A mol:protein length:456 Bifunctional protein glmU  ali model follow..  16  159....SDAQREINEINTGILVANGRDLKRWLSLLDNNNAQGEFYITDIIAKKIATVHPTRLSEVEGVNNRLQLSALERVFQTEQAEKLLLAGVMLLDPSRFDLRGELTHGRDITIDTNVII---EGHVILGDRVRIGTGCVLKNCVGH-LGDAEIGAGVNIGAGTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVHIQ.............................. 447
54 -13.5001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  16  159....TDEQRQIQEINTGILIANGADMKRWLAKLTNNNAQGEYYITDIIAREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVII---EGNVTLGHRVKIGTGCVIKNSVGH-LGDAEIGDNVNIGAKTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKE.............................. 447
55 -13.4002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  16  159....NAEQLNIKEVNTGVMVSDGASFKKWLARVGNNNAQGEYYLTDLIACQVVAVQATDVMEVEGANNRLQLAALERYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVII---EGNVKLGDRVKIGTGCVLKNVVNH-VGDSEIGSNCNIGAGVIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELVITRVAQRHIQ.............................. 447
56 -13.4003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  15  274.....................................................................................ASVSGYAVIKGDTVIGENVLVWMGKGSNAQENCYI----INSRLERNCVTAHGGKIINA--------------------HLGDMIFTGFNSFLSSPLKIGDGCVVMPHTIIDLEIPAGHLVWGYIRN.................................. 393
57 -13.3001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  20  159....TDFEKQIKEINTGTYVFDNERLFEALKNINTNNAQGEYYITDVIGEKVGAYTLKDFDESLGVNDRVALATAESVMRRRINHKHMVNGVSFVNPEATYIDIDVEIASEVQIEANVTL---KGQTKIGAETVLTNGTYVVDSTGH-IGNCEVGSNVNFGAGTIIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKD.............................. 446
58 -13.3001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  20  162....TDFEKQIKEINTGTYVFDNERLFEALKNINTNNAQGEYYITDVIGEKVGAYTLKDFDESLGVNDRVALATAESVMRRRINHKHMVNGVSFVNPEATYIDIDVEIAPEVQIEANVIL---KGQTKIGAETVLTNGTYVVDSTGH-IGNCEVGSNVNFGAGTIIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKD.............................. 449

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.