current user: public




3ixcA
Query: 3ixc_A mol:protein length:191 Hexapeptide transferase family protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MAMGTLEAQTQGPGSMREVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTDSMHGDTVIGKFVTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGYLLast
1 -96.6003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model  100  1MAMGTLEAQTQGPGSMREVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTDSMHGDTVIGKFVTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGYL 185
2 -87.5003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  39  1............SNAMSDTLRPYKNLFPGIGQRVMIDTSSVVIGDVRLADDVGIWPLVVIRGDVNYVAIGARTNIQDGSVLHVTPHGNPLIIGEDVTVGHKVMLHGCTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPQHKRLESGYLYLGSPVKQIRPLSDAERSGLQYSANNYVKWKDDYL 179
3 -87.4003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  37  3..........DQSGKLLTSVRTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGSVLHITPGGYPLIIGDDVTIGHQAMLHGCTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSPGKVLESGFVYMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHL 183
4 -87.2001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  35  1.................MAIYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHG-YPTEIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHI 167
5 -87.1001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  37  3.................AMIYPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQ-YPLILEDDVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYY. 168
6 -86.9003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  40  2..................MIYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSPN-NPLIIEDGVTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYYK 167
7 -71.7003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  28  19............SYAAPPTPWSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTFHIGSRTNIQDGVVIHGLQQEYSVWIGDNVSITHMALIHGAYIGDGCFIGFRSTVFN-ARVGAGCVVMMHVLIPPGKYVPSGMVITQQQADRLPNVEESDIHFAQHVVGINEALLSGY. 206
8 -69.3001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  23  17LALAGSGCISEGAEENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGPIFVGDRSNVQDGVVLHADGKEYAVYIGNNVSLAHQSQVHGAAVGDDTFIGMQAFVFKSK-VGNNCVLEIGVTIPDGRYIPAGMVVTSAEADKLPEVTDDYAYSHTNEAVVYVNVHLAE. 241
9 -64.9003TV0 Entity 1(prereleased)  ali follow..  18  2................SSSMAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQLDFLMKILPNYHHLKKTM. 185
10 -36.7003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  19  48............................SIGNNVRIDDFCILSGKVTIGSYSHIAAYTALYGGEVGIEMYDFANISSRTIVYAAIDSGNALMGPTIPNQYKNVKTGVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVK--ESLDDWYIYVGVPVRKIKARKRKIVELENEFLKSM........ 197
11 -31.8003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  19  17............................RIGAHSRIWHWVHICGGAEIGEGCSLGQNVFVGNR---VRIGNRVKIQNNVSVYDN-----VFLEDDVFCGPSMVFRDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVN--KDVPDFALVVGVPARQIGWMSRHGEQ................. 162
12 -29.1003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  26  91................................NARIEPGALIREKVEIGDQAVIMMGAILNIGAV---VGAGTMIDMGAVL-----GGRATVGKHCHIGAGTVLAGVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVV--EDVPAHTVVAGVPAKVIKQIDDKTKSKTE.............. 228
13 -28.5003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  17  269............................GSASGASVSGYAVIKGDTVIGENVLVSQ----RAYLDNAWMGKGSNAQENCYIINS------RLERNCVTAHGGKIINAHLGDMIFTGFNSFLSSPLKIGDGCVVMPHTIIDLEEEIPAGHLVWGYIRNISFEEFAKVDGEVTMGRMTFRGKGGPFL 429
14 -28.3003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  23  89..............................GIKARIEPGAIIRDHVEIGDNAVIMMNATINIG---AVIGEGSMIDMNAVL-----GGRATVGKNCHVGAGAVLAGVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVT--EDVPPYTVVAGTPARVIKEIDEKTKAKTEIK............ 230
15 -27.1002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  22  81.............................IHKSALISPSAI----VEENAGILIMPYVVINAK---AKIEKGVILNTSSVIEHE-----CVIGEFSHVSVGAKCAGVKIGKNCFLGINSCVLPNLSLADDSILGGGATLV--KNQDEKGVFVGVPAKRMEGGS...................... 201
16 -26.3003fs8_A mol:protein length:273 QdtC  ali model follow..  19  91.............................IGDNFQTGHKVTIRENTKIGNNVKIGTLSDIQHH---VYIGNYVNIHSNVFV-----GEKSIIKDFVWLFPHVVLTNVTIELFAVIAARSVVLPGIHINEDALVGAGAVVT--KDVPKETVVVGNPAREICSIRKIKNK................. 230
17 -26.3003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  19  87............................RIHKNSKIKGDIVA-SKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDI---IISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVT--KDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYH. 239
18 -26.3003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  18  46....................................AERYALQRELFGHLGHKSCVQPPFHCEFGTIRIGDHTFINMNVVM----DGAPITIGDHVLIGPSTQFYTAVIEDDVWIGGNVVINQGVTIGARSVVAANSVVN--QDVPPDTLVGGTPARILRSLKDPAESMAE.............. 195
19 -25.4003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  23  82.............................IHKSALISPSAI----VEENAGILIMPYVVINAK---AKIEKGVILNTSSVIEHE-----CVIGEFSHVSVGAKCAGVKIGKNCFLGINSCVLPNLSLADDSILGGGATLV--KNQDEKGVFVGVPAKRM.......................... 198
20 -25.2003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  18  46....................................EKREDILRQLFGSVGKQINVEQNIRCDYGNIHVGENFFANYDCIF----DVCKIEIGDNVMLAPNVQIYTAKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVT--KDIPPNTVAVGNPCRVIKKIEE..................... 188
21 -25.2001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  19  45....................................EKRESLIKEMFATVGENAWVEPPVYFSYGNIHIGRNFYANFNLTI----DDYTVTIGDNVLIAPNVTLSVTTIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVT--KDIPPNVVAAGVPCRVIREINDRDKHYYFKDYK.......... 198
22 -25.1003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  20  47....................................NKRKELIDQLFQTTTDNVSISIPFDTDYGNVKLGKNVYVNTNCYF----DGGQITIGDNVFIGPNCGFYTAHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVT--KDIPPHSLAVGNPCKVVRKIDNDLPSETLNDET.......... 200
23 -24.7003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  24  78............................................NIHVGKSFFANFNCVI--DVCEVRIGDHCMFAPGVHIYTVERNSGKEYGKPVKIG-----------NNVWVGGGAIINPGVSIGDNAVIASGAVVT--KDVPNNVVVGGNPAKVIKTIEE..................... 190
24 -24.5002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  18  44....................................DKRTGLLKELFGSTGERLFIEPNFRCDYGNIHVGENFFMNFDGVI----DVCEVRIGDHCFIGPGVHIYTAVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVT--KDVPANAVVGGNPAKVIKWLK...................... 185
25 -24.1001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  18  53...............................................FGQVTEAYIEPTFRCDYGNIFLGNNFFANFDCVM----DVCPIRIGDNCMLAPGVHIYTATIGNNVWIGGRAVINPGVTIGDNVVVASGAVVT--KDVPDNVVVGGNPARIIKKL....................... 182
26 -23.3003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  143..............................AGGFRVVPPAIARRGSFIAKNVVLMPSYTNIG----AYVDEGTMVDTWATV-----GSCAQIGKNVHLSGGVGIGGVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQS--TKIYDRETGEVTYGRIPAGS..................... 274
27 -23.1002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  14  80.............................................LQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDV---IIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKS---EPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFY. 214
28 -21.8001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  18  33.............................................................GEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVV--KDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWW........ 182
29 -21.1001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  18  25....................FCVIGDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVLKGEYSELIIGEDNLIREFCMINTEGGIKKTLIGDKLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQGKDVPPYCTVEGNRAFIRQLLESKDIDFIYAL............ 213
30 -20.6002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  14  203........................DKFPRFLAHIIPEDNTRILESSKVRMGASLAAGTTIMPGASYVNFN--AGTTGACMVEGRISSS-AIVGEGSDVGGGASILGISVGKACLLGANSVT--GIPLGDNCIVDAGIAVLEG--TKFLLKDAEELAKLNPYFNFDKEI................. 348
31 -20.6003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  21  101.............................QREGFRVVPPATVRKGAFIARNTVLMPSYVNIG----AFVDEGTMVDTWATV-----GSCAQIGKNVHLSGGVGIGGTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRI........................................ 216
32 -20.5003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  104.............................QKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIG----AYVDEGTMVDTWATV-----GSCAQIGKNVHLSGGVGIGGTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRI........................................ 219
33 -20.1001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  19  99.............................QKEGFRVVPPATVRQGAFIARNTVLMPSYVNIG----AYVDEGTMVDTWATV-----GSCAQIGKNVHLSGGVGIGGTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSGRVPAGSVVVSGCAVIVKKVDAKTRGKVG.............. 265
34 -20.1002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  16  35........................GPHVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIAGEPTRVEIGDRNRIRESVTIHTVQGGGLTKVGSDLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSG............................. 178
35 -20.0003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  18  28....................YAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDQKSGVVIGKNATIREFATINTAKGDGFTRIGDNFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQSQDIVPFCLAEGNRASIRRRFDKDEVDRLSRA............ 217
36 -19.7003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  21  131...................................IVRHSAYIAPNAILMPSFVNLGAY---------VDKGAMIDTWATV-----GSCAQIGKNVHLSGGVGIGGVIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIG--KSTKIVDRATGEVFY............................ 245
37 -19.7001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  18  19..............................................................SNPNIRVGRYSYYSGYYHGHSFDDCAKLVIGSFCSIGSGAAFGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVT--GDVEPYAIVGGNPARTIRKRFSDGDIQNLLEMAWW........ 179
38 -19.5003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  20  21..............................................................TNPNIIVGKHSYYSGYYHGHSFDDVDKLVIGSFCSIGSGAVFHDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVT--KDVAPYEVVGSNPAKHIKFRFSDVEIAMLLEMAWW........ 180
39 -19.2003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  20  24....................YSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVIGVLLTKTVIGDHNIFREYSNIH-TKEDSPTVIGNKYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAK............................. 171
40 -18.1001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  19  127..................................YLQNQISVAFDVDIHPAAKIGHGIMFDHATG-IVVGETSVIENDVSIL-----------QGVTLGGTGKESG-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVL--NPVPEYATAAGVPARIVSQDKAAK................... 247
41 -18.1001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  19  129..................................YLQNQISVAFDVDIHPAAKIGHGIMFDHATG-IVVGETSVIENDVSIL-----------QGVTLGGTGKESG-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVL--NPVPEYATAAGVPARIVSQDKAAK................... 249
42 -17.9003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  22  148..................................YLQSRSSSIFQTDIHPAARLGSGLFLDHATG-LVVGETAVVEDNVSIL-----------HGVTLGGTGKSSG-KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVL--KSVPHNVTVAGVPARIIGETGCTE................... 268
43 -17.9003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  19  134..................................YLQNQVSVAFGVDIHPAATIGCGIMLDHATG-IVIGETAVVENDVSIL-----------QSVTLGGTGKTSG-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVL--QSVPAHTTAAGVPARIVGKPESDK................... 254
44 -17.8001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  21  141..................................FLQNQVSVTFQVDIHPAAKIGRGIMLDHATG-IVVGETAVIENDVSIL-----------QSVTLGGTGKSGG-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVL--QPVPPHTTAAGVPARIVGKPDSDK................... 261
45 -17.7003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  13  158.............................VPTGVRIADADRVRLGAHLAPGTTVMHEGFVN----------NAGTLGASMVEGRISAG-VVVGDGSDVGGGASIMGISIGKRCLLGANSGL--GISLGDDCVVEAGLYVTAG--TRVTMPDSNSVKA--RELSGSSNLLFRRNS........... 295
46 -16.8003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  15  181.............................VPAGVRIADTARVRLGAYIGEGTTVMHEGFVN----------NAGTEGPGMIEGRVSAG-VFVGKGSDLGGGCSTMGISVGEGCLIGANAGI--GIPLGDRNIVEAGLYITAG--TKVALLDEQNLVKVVKARDLAGQPDLLFRRNS......... 323
47 -16.3002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  21  247.............................IEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTEKNKIGASVEVKEGSKIPHLSYVGDSVIAEDVNFGAGTLILGAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRD--VGYGEFFK................................. 400
48 -16.3002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  21  164........................GAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSC-DDVEIGANTTI-DRGRFKHSVVREGSKIDNLVQIAHQVEV-STKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKS--ITSPGIYGGAPARPYQE........................ 333
49 -15.3003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  18  159........................GARSVIGEGGWLAPRVTLYHDVTIGARVSIQSGAVIGGE-DDVEIGANTTI-DRGALSDTLIGNGVKLDNQIMIAHNVQI-SAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSIT-EPGSYSSGTAMQPAAE........................ 328
50 -15.2003eh0_A mol:protein length:341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  19  143........................GKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGAD-DRVEIGACTTI-DRGALDDTIIGNGVIIDNQCQIAHNVVI-SLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPIT-EPGVYSSGIPLQPNKV........................ 312
51 -14.7003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  14  155..................................EMMESVHSYTSIDIHPGASIKGHFFIDHGVG-VVIGETAIIGEWCRIYQSVTLGAMHFQEEGGVIKRGTKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVYISEHPTHFVKPCTTKG................... 285
52 -14.7003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  17  180..................................FITEMAHSETGIDIHPGAQIGHHFTIDHGTG-VVIGATSIIGNNVKLY-----------QGVTLGAKSF-H--ILEDDVIVYSNATILGRVTIGKGATVGGNIWVT--ENVPAGSRIVQRKNKDELE........................ 304
53 -14.2003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  21  281............................TIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVADGAAVGPFTYLRPGTALHLTY--GDADIGEYSNIGASSVFRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVR--EDVPPGALAVSAGPQRNIE........................ 460
54 -13.6001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  24  270............................EIAPEVQIEANVILKGQTKIGAETVLTNGTYVVDSTDGVTVGPYAHIRPNSSLHLTY--GNCEVGSNVNFGAGTITYKTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTIT--KDVPADAIAIGRGRQINKD........................ 449
55 -13.5001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  26  267............................EIASEVQIEANVTLKGQTKIGAETVLTNGTYVVDSTDGVIVGPYAHIRPNSSLHLTY--GNCEVGSNVNFGAGTITYKTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTIT--KDVPADAIAIGRGRQINKD........................ 446
56 -13.5001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  24  267............................THGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKNSVAACTIGPFARLRPGAELHLTY--GDAEIGDNVNIGAGTITFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVT--RNVGENALAISRVPQTQKE........................ 447
57 -13.4002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  25  267............................EHGKDVEIDVNVIIEGNVKLGDRVKIGTGCVLKNVVEKAAIGPFSRLRPGAELHLTY--GDSEIGSNCNIGAGVITFKTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTIT--RDVGENELVITRVAQRHIQ........................ 447
58 -13.4003fww_A mol:protein length:456 Bifunctional protein glmU  ali model follow..  25  267............................THGRDITIDTNVIIEGHVILGDRVRIGTGCVLKNCVANCTVGPFARLRPGAELHLSY--GDAEIGAGVNIGAGTITFKTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVT--RDVAENELVISRVKQVHIQ........................ 447
59 -10.5002f9c_A mol:protein length:334 Hypothetical protein YDCK  ali model follow..  10  156......................................DRATVNHSRIVHQVQLYGNATI----THAFIEHRAEVFDFALIEGDKDNNVWICDCAKVYGHARVIAGTEEDAIPTLRYSSQVAEHALIEGNCVLKHHVLVGGHAEVRGGPILLDDRVLIEGHACIQGEILIERQVE.......... 288

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 8 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Harder T, Kolodny R, Sitbon E, Li Z, Godzik A. Using an alignment of fragment strings for comparing protein structures. Bioinformatics. 2007 Jan 15;23(2):e219-24.