current user: public




Query: 3ixc_A mol:protein length:191 Hexapeptide transferase family protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MAMGTLEAQTQGPGSMREVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTDSMHGDTVIGKFVTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGYLLast
1 -98.7003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model  100  1MAMGTLEAQTQGPGSMREVLVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTDSMHGDTVIGKFVTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGYL 185
2 -91.9003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  37  3..........DQSGKLLTSVRTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGSVLHITHGGYPLIIGDDVTIGHQAMLHGCTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSPGKVLESGFVYMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHL 183
3 -91.9003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  39  1............SNAMSDTLRPYKNLFPGIGQRVMIDTSSVVIGDVRLADDVGIWPLVVIRGDVNYVAIGARTNIQDGSVLHVTHHGNPLIIGEDVTVGHKVMLHGCTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPQHKRLESGYLYLGSPVKQIRPLSDAERSGLQYSANNYVKWKDDYL 179
4 -91.3003tio_A mol:protein length:183 Protein YrdA  ali model follow..  39  1................SDVLHPYRDLFPQIGQRVMIDDSSVVIGDVRLADDVGIWPLVVIRGDVHYVQIGARTNIQDGSMLHVTHDGNPLTIGEDVTVGHKVMLHGCTIGNRVLVGMGSILLDGAIVEDDVMIGAGSLVPQNKRLESGYLYLGSPVKQIRPLSDEEKAGLRYSANNYVKWKDEYL 175
5 -81.3004mfg_A mol:protein length:168 Putative acyltransferase  ali model follow..  41  2................NAMIRDYLEDKPLIDESVFVAKSADVIGNVKIGKDSSIWYNAVVRGDEGPITIGENTNIQDCSIVHGDT---ETIIGNNVTVGHRSIVHGCKISDNVLIGMGSIILDNAEIGEYTLIGAGTLITSNKKFPPGVLIMGSPGKVVRELTEEDKKYIDESYEWYLEAAQNQ. 166
6 -80.5001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  37  2................NAMIYPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSP-QYPLILEDDVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKIPPNTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYY. 168
7 -79.4003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  40  1.................GMIYPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSP-NNPLIIEDGVTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYY. 166
8 -78.5001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  35  2..................AIYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSH-GYPTEIGEYVTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKH. 166
9 -69.3004n27_A mol:protein length:195 Bacterial transferase hexapeptide repeat  ali model follow..  36  16..................PIYAYNGHKPQFRESNWIAPDATLIGKVVVGENAGFWFGAVLRGDNEPITIGADTNVQEQTIMHTDI-GFPLTIGAGCTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKEGMEIPDNSLVVGSPARVLRQLDDAAVEKLRASAKHYVERGHSF. 182
10 -65.5005adx_V mol:protein length:165 DYNACTIN SUBUNIT 6  ali model follow..  16  1...............................SGNKVSRQSVLCGNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT 163
11 -62.7001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  25  51..................TPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMIFVGDRSNVQDGVVLHALETEYAVYIGNNVSLAHQSQVHGAAVGDDTFIGMQAFVFKSKVGNNCVLAAIGVTIPDGRYIPAGMVVTSAEADKLPEVTDDYAYSHTNEAVVYVNVH.... 238
12 -62.7003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  26  24.................PTPWSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTFHIGSRTNIQDGVVIHGLQQEYSVWIGDNVSITHMALIHGAYIGDGCFIGFRSTVFN-ARVGAGCVVMMHVLIQDVEIPPGKYVPSGMVITTQQQVEESDIHFAQHVVGINEALLSGYQ 207
13 -52.6005adx_U mol:protein length:190 DYNACTIN 5  ali model follow..  18  1...................MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQLDFLMKILPNYHHLKKTM. 181
14 -52.2003tv0_A mol:protein length:194 Dynactin subunit 6  ali model follow..  18  2................SSSMAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERLQLDFLMKILPNYHHLKKTM. 185
15 -50.1005afu_U mol:protein length:168 DYNACTIN  ali model follow..  19  1...............................PGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINPDTEKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRERPQPTLQLDFLMKILPNYHHLKKTM. 164
16 -36.9003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  19  268...........................AGSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNA----WMGKGSNAQENCYIINS------RLERNCVTAHGGKIINAHLGDMIFTGFNSFLQGSESIGDGCVVMPHTIIDEPLEIPAGHLVWGEFAKVDGEVTMGRMTFRGKGGPFLDSFKKRI. 436
17 -31.2003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  19  48............................SIGNNVRIDDFCILSGKVTIGSYSHIAAYTALYGGEVGIEMYDFANISSRTIVYAAIDDFSGNALMGPTI-KNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVK--ESLDDWYIYVGVPVRKIKARKRKIVELENEFLKS......... 196
18 -28.9003fs8_A mol:protein length:273 QdtC  ali model follow..  18  90............................IIGDNFQTGHKVTIRENTKIGNNVKIGTLSDIQHH---VYIGNYVNIHSNVFV-----GEKSIIKDFVWLFPHVVLLGVTIELFAVIAARSVVLPGIHINEDALVGAGAVVT--KDVPKETVVVGNPAREICSIRKIKNKITGEQVYPW........ 239
19 -23.9004m9c_A mol:protein length:216 Bacterial transferase hexapeptide (Three repe  ali model follow..  24  92.................................AVQSTNTVILDEVEIGEGSLLCPFTCLTSN---IKIGKFFHANIYSYV-----AHDCVIGDYVTFAPGAKCNGIHIEDHAYIGTGAVIKQGLIIGKGAIVGMGAVVT--KSVPAGVTVVGNPARILER........................ 215
20 -22.8004ea7_A mol:protein length:220 Perosamine N-acetyltransferase  ali model follow..  22  100.................................NAIHPSAVVSPSVRLGEGVAVMAGVAINADS---WIGDLAIINTGAVVD-----HDCRLGAACHLGPASALAGVSVGERAFLGVGARVIPGVTIGADTIVGAGGVVV--RDLPDSVLAIGVPAKIKGD........................ 218
21 -22.8004m98_A mol:protein length:208 Pilin glycosylation protein  ali model follow..  21  92.................................VLIHPDATVSPSAIIGQGSVVMAKAVVQAGS---VLKDGVIVNTAATV-----DHDCLLDAFVHISPGAHLSGTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIV--CDIPDGMTVAGNPAKPL.......................... 208
22 -22.1002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  21  81.............................IHKSALISPSAIV----EENAGILIMPYVVINAKA---KIEKGVILNTSSVIE-----HECVIGEFSHVSVGAKCAGVKIGKNCFLGINSCVLPNLSLADDSILGGGATLV--KNQDEKGVFVGVPAKRMEG........................ 199
23 -21.9003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  16  52......................QRELFGHLGHKSCVQPPFHC--TIRIGDHTFINMNVVM--DGAPITIGDHVLIGPSTQFYTASHS----LDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVN--QDVPPDTLVGGTPARILRSLKDPAESMAE.............. 195
24 -21.9003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  19  87............................RIHKNSKIKGDIVA-SKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDI---IISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVT--KDVPSMCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYH. 239
25 -21.6004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  17  12............................NIGDNTKVWQFCVILAGAVIGRNCNICANSLIEND---VVIGDNVTIKSGVQIW-----DGIHIQDDVFIGPNVTFLKTIVKKGASIGANSTILPGILIGENAMVGAGAVIT--KNVPDNAIVIGNPGRITGYVEA..................... 152
26 -21.6004dcl_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  19  44....................................LKRKVLIDALFQTTTDNVSISIPFDTDYGWVKLGKNVYVNTNCYF----DGGQITIGDNVFIGPNCGFYTAHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVT--KDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIKLE...... 201
27 -21.5004egg_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  19  44....................................MMRKVLIDALFQTTTDNVSISIPFDTDYGWVKLGKNVYVNTNCYF----DGGQITIGDNVFIGPNCGFYTAHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVT--KDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIKLE...... 201
28 -21.4001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  17  51......................IKEMFATVGENAWVEPPVYF--NIHIGRNFYANFNLTI--DDYTVTIGDNVLIAPNVTLSVTGH-----VHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVT--KDIPPNVVAAGVPCRVIREINDRDKHYYFKDYK.......... 198
29 -21.3003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  25  94...................................IEPGAIIRDHVEIGDNAVIMMNATIN-----AVIGEGSMIDMNAVL-----GGRATVGKNCHVGAGAVLAGVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVT--EDVPPYTVVAGTPARVIKEIDEKTKA................. 225
30 -21.2003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  27  94...................................IEPGALIREKVEIGDQAVIMMGAILN-----AVVGAGTMIDMGAVL-----GGRATVGKHCHIGAGTVLAGVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVV--EDVPAHTVVAGVPAKVIKQIDDKTKS................. 225
31 -21.2002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  14  80.............................................LQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDV---IIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLY-KSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFY. 214
32 -21.1003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  20  47....................................NKRKELIDQLFQTTTDNVSISIPFDTDYGWVKLGKNVYVNTNCYF----DGGQITIGDNVFIGPNCGFYTAHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVT--KDIPPHSLAVGNPCKVVRKIDNDLPSETLNDET.......... 200
33 -21.0003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  22  82.............................IHKSALISPSAIV----EENAGILIMPYVVINAKA---KIEKGVILNTSSVIE-----HECVIGEFSHVSVGAKCAGVKIGKNCFLGINSCVLPNLSLADDSILGGGATLV--KNQDEKGVFVGVPAKRM.......................... 198
34 -20.8003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  21  1..............................GHMATIHPTAIVDEGARIGAHSRIWHWVHICGGANRVRIGNRVKIQNNVSVY-----DNVFLEDDVFCGPSMVFRDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVN--KDVPDFALVVGVPARQIGWMSR..................... 158
35 -20.8003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  24  78............................................NIHVGKSFFANFNCVI--DVCEVRIGDHCMFAPGVHIYTAERNSGKEYGKPVKIG-----------NNVWVGGGAIINPGVSIGDNAVIASGAVVT--KDVPNNVVVGGNPAKVIKTIEE..................... 190
36 -20.5004r36_A mol:protein length:275 Putative acyl-[acyl-carrier-protein]--UDP-N-a  ali model follow..  20  38.....................VYIDRNVVIGDNNKIMANANILYGSRIGNGNTIFPGAVIKGEESTAEIGDNNLIRENVTIN-TAAKGRTIVGNNLLMEGVHVAHDALIGNGCIVGNSTKMAGEIIIDDNAIISANVLMHQFCRVGGYVMIQG................................ 180
37 -20.3003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  22  52......................LRQLFGSVGKQINVEQNIRC--NIHVGENFFANYDCIF--DVCKIEIGDNVMLAPNVQIYTALRNSGIEYGSPVKIG-----------DNVWIGGGVIITPGITIGDNVVIGAGSVVT--KDIPPNTVAVGNPCRVIKKIEE..................... 188
38 -20.1002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  21  50......................LKELFGSTGERLFIEPNFRC--NIHVGENFFMNFDGVI--DVCEVRIGDHCFIGPGVHIYTAERNSGLEYGKPVVIG-----------HNVWIGGRAVINPGVTIGDNAVIASGAVVT--KDVPANAVVGGNPAKVIKWLK...................... 185
39 -20.0001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  22  72............................................NIFLGNNFFANFDCVM--DVCPIRIGDNCMLAPGVHIYTAARNSGAELGKPVTIG-----------NNVWIGGRAVINPGVTIGDNVVVASGAVVT--KDVPDNVVVGGNPARIIKKL....................... 182
40 -18.9001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  29........................GDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVLKGEYSELIIGEDNLIREFCMINTEGGIKKTLIGDKLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSA............................. 172
41 -18.4005dem_A mol:protein length:258 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  22  29........................GAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVKGEPTRLVIGDHNVIREGVTIHTVQDRAETTIGDHLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQGKDVPAYVTVFGNPAE-ARSMNFEGMRRRGFSSEAIHALRRAY. 215
42 -18.4005b04_I mol:protein length:678 Probable translation initiation factor eIF-2B  ali model follow..  17  315.............................KEEDVVLARSCIIKARTLIGAYTKVGDASVVANTI----IGRNCTIGSNCSID------SAFLWEDVVIGDNCRIGKAILANSVKIGNNCSIEDGAIVAAGVVIGDNTIIEKNKRL........................................ 420
43 -18.3003t57_A mol:protein length:305 UDP-N-acetylglucosamine O-acyltransferase dom  ali model follow..  20  35........................GSSVKLGNGCKLYPSSHVFGNTELGESCVLMTGAVVHGDECFLCIGNNNEIREFCSIH-SKPSDKTVIGDNLIMGSCHIAHDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASVVHQSQDVPKYMMVAGERAE-LRGLNLEGLRRNGFTMSEMKSLRAAY. 243
44 -18.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  17  35........................GPHVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIAGEPTRVEIGDRNRIRESVTIHTVQGGGLTKVGSDLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQAQDVPPYVIAQGNHAT-PFGVNIEGLKRRGFSREAITAIRNAY. 221
45 -17.9003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  32........................SKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDQKSGVVIGKNATIREFATINTAKGDGFTRIGDNFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASA............................. 176
46 -17.7003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  20  28........................EGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVIGVMLTKTVIGDHNIFREYSNIH-TKEDSPTVIGNKYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQVQDVPPYSTVDGNPST-VVGLNSVGMKRAGFSPEVRNAIKHAY. 214
47 -17.6004e6t_A mol:protein length:294 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  18  58........................GPQVTIGAGTKLHSHVVVGGFTRIGQNNEIFQFASVKGEETWLEIGNNNLIREHCSLHTVQDNALTKIGSHLLMVNTHIAHDCIVGDHNIFANNVGVAGHVHIGDHVIVGGNSGIHQLKDVPAYVMASGNPAH-AFGINIEGMRRKGWSKNTIQGLREAY. 244
48 -17.5004eqy_A mol:protein length:283 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  17  44........................GSNVTIGARTTIGSHSVIEGHTTIGEDNRIGHYASVKDEPTRLVIGDRNTIREFTTIHTVQDAGVTTLGDDWIMAYVHIGHDCRVGSHVVLSSNAQMAGHVEIGDWAIVGGMSGVHQVQDIPPFVIAAGNKAE-PHGINVEGLRRRGFSPDAISALRSAY. 230
49 -16.3004hur_A mol:protein length:220 Virginiamycin A acetyltransferase  ali model follow..  19  12................PENILPIKGNRNLQFIKPTITNENILVGEYSYYDSK------------------RGESFEDQVLYHYEVIGDKLIIGRFCSIGPGTIMNGANIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVT--KNVAPYSIVGGNPLKFIRKRFSDGV.................. 178
50 -15.9001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  22  30..........................................................VEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVIMNGANIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVV--KDIAPYMLAGGNPANEIKQRFDQDT.................. 172
51 -15.8003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  16  1................SNAMNFFTSPFSGIPLDQQVTNPNIIVGKHSYYSGDCVRYLHPERDDVDKLVIGSFCSIGSGAVFMMAGNQGHRSDWISTARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVT--KDVAPYEVVGSNPAKHIKFRFSDVE.................. 170
52 -15.2002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  21  162......................VIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSC-DDVEIGANTTI-DRGRFKHSVVREGSKIDNLVQIAHQVEV-STKIGNHVIIGGQAGITGHICIADHVIMMAQTGVT--KSITSPGIYGGAPARPYQEIHRQVA.................. 339
53 -15.1005b04_E mol:protein length:458 Probable translation initiation factor eIF-2B  ali model follow..  13  344.............................RLVDVTVSERALVGADCMVNEGTTIKDNSNIKKSI----IGKNCVIGKGVVVS------NSILMDNIVVEDGVRLESCIVASGAQIGAKS-KLRECEIGVDHRVEAGRIARGERLVDMEKI................................... 453
54 -14.9001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  16  135........................................................SVAFDVDIHAAKIGHGIMFDHATGIVV---GETSVIENDVSILQGVTLGGTKVREGVMIGAGAKILGNIEVGKYAKIGANSVVL--NPVPEYATAAGVPARIVSQDKAAK................... 249
55 -14.9001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  16  133........................................................SVAFDVDIHAAKIGHGIMFDHATGIVV---GETSVIENDVSILQGVTLGGTKVREGVMIGAGAKILGNIEVGKYAKIGANSVVL--NPVPEYATAAGVPARIVSQDKAAK................... 247
56 -14.8003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  18  140........................................................SVAFGVDIHAATIGCGIMLDHATGIVI---GETAVVENDVSILQSVTLGGTKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVL--QSVPAHTTAAGVPARIVGKPESDK................... 254
57 -14.8004hzd_A mol:protein length:282 CysE, serine acetyltransferase  ali model follow..  20  147........................................................SSIFQTDIHAARLGSGLFLDHATGLVV---GETAVVEDNVSILHGVTLGGTKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVL--KSVPHNVTVAGVPARIIGETGCTE................... 261
58 -14.8001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  15  18...................................VSNPNIRVGRYSYYSGDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHRAEWASTAVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVT--GDVEPYAIVGGNPARTIRKRFSDGD.................. 169
59 -14.7004h7o_A mol:protein length:281 Serine acetyltransferase  ali model follow..  17  137........................................................SVACQVDIHAARIGRGIMLDHATGIVI---GETAVVEDDVSILQDVTLGGTKIREGVMIGAGAKILGNIEVGEGAKIGSGSVVL--QAVPPHTTVAGVPARIVGRPQSDK................... 251
60 -14.7003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  20  154........................................................SSIFQTDIHAARLGSGLFLDHATGLVV---GETAVVEDNVSILHGVTLGGTKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVL--KSVPHNVTVAGVPARIIGETGCTE................... 268
61 -14.7004n69_A mol:protein length:286 Serine Acetyltransferase Apoenzyme  ali model follow..  24  148........................................................ANVFAVDIHAARIGKGILFDHATGVVV---GETAVIGNNVSILHHVTLGGTKIGDGVLIGAGATILGNIKIGEGAKVGAGSVVL--IDVPPRTTAVGNPARLV.......................... 255
62 -14.7001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  19  147........................................................SVTFQVDIHAAKIGRGIMLDHATGIVV---GETAVIENDVSILQSVTLGGTKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVL--QPVPPHTTAAGVPARIVGKPDSDK................... 261
63 -14.6002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  19  247.............................IEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTEKNKIGASVEVKESVIMEGSKIPHDSVIAEDVNFGAGTLILGAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVN--RDVGYGEFFK................................. 400
64 -13.8004ihf_A mol:protein length:348 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acy  ali model follow..  18  142......................FVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGAD-DRVEIGACTTI-DRGALDDTIIGNGVIIDNQCQIAANVVI-SLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVM-RPITEPGVYSSGIPLQPNKV........................ 313
65 -13.5004e75_A mol:protein length:357 UDP-3-O-acylglucosamine N-acyltransferase  ali model follow..  17  146......................KLDDNVEVGKDCFIDSYVTITGSSKLRDRVRIHSSTVIGGE-NDVRIGSNCSI-DRGALDNTILEDGVIIDNLVQIAHNVHI-STKIGKNCILAGACGVAGHLSIADNVTLTGMSMVT-KNISEAGTYSSGTGLFENNH........................ 317
66 -13.5003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  17  157......................VIGARSVIGEGGWLAPRVTLYHDVTIGARVSIQSGAVIGGE-DDVEIGANTTI-DRGALSDTLIGNGVKLDNQIMIAHNVQI-SAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVT-RSITEPGSYSSGTAMQPAAE........................ 328
67 -12.9002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  14  203........................DKFPRFLAHIIPEDNTRILESSKVRMGASLAAGTTIMPGASYVNFNAGT---TGACMVEGRISSSAIVGEGSDVGGGASILGVSVGKACLLGANSVT--GIPLGDNCIVDAGIAVLEGTKF........................................ 327
68 -12.6004fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  25  270............................THGRDITIDTNVIIEGHVILGDRVRIGTGCVLKNCVANCTVGPFARLRPGAELHLSYLG-DAEIGAGVNIGAGTITFKTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVT--RDVAENELVISRVKQV........................... 447
69 -12.6002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  25  267............................EHGKDVEIDVNVIIEGNVKLGDRVKIGTGCVLKNVVEKAAIGPFSRLRPGAELHLTYVG-DSEIGSNCNIGAGVITFKTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTIT--RDVGENELVITRVAQR........................... 444
70 -12.6001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  23  267............................THGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKNSVAACTIGPFARLRPGAELHLTYLG-DAEIGDNVNIGAGTITFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVT--RNVGENALAISRVPQT........................... 444
71 -12.5001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  25  260.....................TYIDIDVEIASEVQIEANVTLKGQTKIGAETVLTNGTYVVDSTDGVIVGPYAHIRPNSSLHLTYIG-NCEVGSNVNFGAGTITYKTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTIT--KDVPADAIAIGRGRQINKD........................ 446
72 -12.5001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  23  263.....................TYIDIDVEIAPEVQIEANVILKGQTKIGAETVLTNGTYVVDSTDGVTVGPYAHIRPNSSLHLTYIG-NCEVGSNVNFGAGTITYKTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTIT--KDVPADAIAIGRGRQINKD........................ 449
73 -12.2003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  19  274.....................TWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTVVRTHGSSSSIGDGAAVTGTKVPHLTYVG-DADIGEYSNIGASSVFRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVR--EDVPPGALAVSAGPQ............................ 456
74 -11.5003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  15  169............................RVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAVVVGDGSDVGGGASIMGTLSGHVISIGKRCLLGANSGL-GISLGDDCVVEAGLYVTAGTRVPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHA............ 318
75 -11.1003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  16  192............................RVRLGAYIGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAVFVGKGSDLGGGCSTMGTLSGIVISVGEGCLIGANAGI-GIPLGDRNIVEAGLYITAGTKVALVKVVKARDLAGQPDLL........................................ 318

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.