current user: public




Query: 3ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQRLRSQALDAFDGADYTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKSDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSVAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYEAAQEHNENDQQIREGLEKAQRLLKQSQKRLast
1 -110.0003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model  100  1ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQRLRSQALDAFDGADYTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKSDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSVAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYEAAQEHNENDQQIREGLEKAQRLLKQSQKR 359
2 -94.0002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model follow..  96  18ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKR 376
3 -67.5002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  17  6..ALALKDKGNQFFRNKKYDDAIKYYNWALELKED-PVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFP-RVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAIAKVQQRIRSDPV. 506
4 -65.7003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  17  25..AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSRGSQVLPSNTSLAS-QESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFF------------AEILTDRGDFDTAIKQYDIAKRLEEVQEKIILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTFAE--AAKIQKR 513
5 -64.9001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  16  31DNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCV---------------RSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHG------------NLACVYYEQGLIDLAIDTYRRAIELQPHFPD----AYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQE. 357
6 -61.9003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  14  20.YHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARALDPADIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNLQADVDIDDLNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVM------------YNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFGLQSM................................................ 325
7 -61.4004ui9_F mol:protein length:824 CELL DIVISION CYCLE PROTEIN 27 HOMOLOG  ali model follow..  13  497NTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYA---------------YTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCK------------FHRASVLFANEKYKSALQELEELKQIVPKES----LVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDE. 823
8 -61.3003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  14  20.YHENPMEEGLSMLKLANLAEAALAFEAVCQAAPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNLQADVDIDDLNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVM------------YNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFG.................................................... 321
9 -60.4001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  12  3TSWRKSEVLAVPLQPTLQQEVILARMEQILATDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYA-------------------------------------------------HLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKEVLKQHFEKSDKEQWGWNIVEFYLGNIS-------------EQTLMERLKADATDNTSLAEHLSE----TNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLLGQDQDDLAESDQ............................ 274
10 -59.3005aio_A mol:protein length:448 TRANSCRIPTION FACTOR TAU 131 KDA SUBUNIT  ali model follow..  14  9.EVAQLLSQANEAFVRNDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLNDCCNSWFLAAHLNASDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWES---------------IYRRSMLYKKTGQLARALDGFQRLYMYNPYDANILRELAILYVDYDRIEDSIELYMKVFNANVERREAILAALENALDSSDEESAAEGEDADEKEPLEQDEDRQMFPDINWIDIRVRLGLLRLNTDNLVEALNHFQCLYDETFSD----ADLYFEAATALTRAEKYKEAIDFFTPLLSLEERTTDVFKPLARCYKEIESYETAKEFYELAIKSEPDDLDIRVSLAEVYYRLNDPET. 436
11 -59.2004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  11  1..............GAMEFERAKAAVESDTEFWDKMQAEWRRNWISENQEAQNQVTVSASEKGYYFHTENWPGAFEEGLKRLKEGDLPVTILFMEAAILQDPGDAEA---------------WQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTSHQQDACEALKNWIKQNPKYKYLVKNKKGSPGLTRRMSKSPVDSSVLEGVKELYLEAAHQNGDMIDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYS----LWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNIWAALRIALSLMDQPE.. 344
12 -58.0003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  14  23.DHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRS--------------------------------------------------RYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAALSMLGQSDAYGAADARDLSTLLTMFGLPQ............... 328
13 -57.9004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  13  233NTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYA---------------YTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCK------------FHRASVLFANEKYKSALQELEELKQIVPKES----LVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDE. 559
14 -57.6003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  12  1................GSYKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVS---------------WFAVGCYYLMVGHNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEV------------GVVAFQNGEWKTAEKWFLDALEKIKAIGNEVEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSE. 322
15 -57.3003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  18  3SMADKEKAEGNKFYKARQFDEAIEHYNKAWELHKD-ITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLT--------------------------------------------------EHRTADILTKLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARG--------------------------------------------------YSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQ.. 258
16 -57.3001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  14  62RDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRS--------------------------------------------------RYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAALSMLGQSDAYGAADARDLSTLLTMFGLPQ............... 368
17 -56.9003zgq_A mol:protein length:482 INTERFERON-INDUCED PROTEIN WITH TETRATRICOPEP  ali model follow..  13  49SRLALYNLLAYVKHLKGQNKDALECLEQAEEIEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKIGNVCKKLSSPEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGYAIT--------VYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAEAEGEKYIEEILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTPTSSFLHHQMGLCKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAF----AYTDLANMYAEGGQYSNAEDIFRKALRLEALDVQSLSALGFVYKLEGEKRQAAEYYEKAQKIDPENAEFLTALCELRLSI...... 482
18 -56.2004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  18  3.SYEELIEKSYDFVDKGDLVSAEESLKAAMRKEPANYALLTNLGTIQRRQGKLQEALISYTSALSGHTKNITILENRASLYTELGETEKALNDYNTLLIENPEHQEA-------------------------------------------------LYCRGLLYIQLQNYMWAEQDFDKILEVNEKSVRARLGHAILEKMRGNYDESERIFNYLISEMPRDWIL--------------------------------------------------YEGRADLYFMMGKNARAMADIEKVFTESEPTANLYVLRGKIKLAQYEKERAALDFKKAESMGYNKEVIKELLKLTM......... 255
19 -56.1005a31_C mol:protein length:597 CELL DIVISION CYCLE PROTEIN 23 HOMOLOG  ali model follow..  10  261KSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGA---------------WTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMAL------------VKLAKLHEQLTESEQAAQCYIKYIQDIYSCGEIVSTAFRYLAQYYFKCKLWDEASTCAQKCCAFNDTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPL....... 590
20 -55.6003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  13  2.NDDVEFRYADFLFKNNNYAEAIEVFNKLEAKKYNSPYIYNRRAVCYYELAKYDLAQKDIESKVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDM---------------YGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANAAQDPDTKAKPYYEKLIEVCAPG------------------------------------------GAKYKDELIEANEYIAYYYTINRDKVKADAAWKNILALDPTNKKAIDGLKMKL........................................... 265
21 -55.3005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  16  356.ASVVYDLLTIALGRRGQYEMLSECLERAMKFAFEEFHLWYQFALSLMAAGKSARAVKVLKECIRLKPDDATIPLLAAKLMGSLHWLEEAEKFAKTVVDVGEKTSEFKAKGYLALGLTYSLQATDASLRGMQEVLQRKALLAFQRAHSLSPTDHQAAFYLALQLAISRQIPEALGYVRQALQLQGDDANSLHLLALLLSAQKHYHDALNIIDMALSEYPENFILLFSKVKLQSLCRGPDEAEVYIGIGKPAEATACTQEAANLFPMSHN----VLYMRGQIAELRGSMDEARRWYEEALAISPTHVKSMQRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAA. 810
22 -54.5004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  12  8PKEITLFRTALKCYETKQYKKGLKAIEPLLERHPEHGESLAIKGILLHSLGNTKEGYDNVRLGLRNDVGSGVCWHIFGLISRADKDYVQAAKCYINAHKLEKNNSSLLRDLALLQNPGVRANWSALAVAQFLRGEYASAYKIVDAFESTINQGSEAMLFMNLVILKKDGVEDAYKHLLSIEKKVLDRVAFLETRAEYELYLSKMEEAKSTIYLLLDRNPDNHQYYYNLQRAYGYEDASGKVLDSKKCKVVEDLVSKYASSLSTTNKFSEDDDNTYYFLAQHFDHVGELEKAEKYVDLAIDHTPTLVELFMTKARISKHKGELQTAMEIMDHARKLDLQDRFINGKCAKYMLRNDENEL. 466
23 -53.4004g1t_A mol:protein length:472 Interferon-induced protein with tetratricopep  ali model follow..  14  50.KATMCNLLAYLKHLKGQNEAALECLRKAEELEIRSLVTWGNYAWVYYHMGRLSDVQIYVDKVKHVCEKFSSPYEGWTRLKCGGNQNERAKVCFEKALEKKPKNPEFTSGLAIASYRLDNWPPSQNAIDPLRQEEEGEGEKLVEEALEKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYIPNNAYLHCQIGCCYRALELIGHAVAHLKKADEANDNLFRVCSILASL------------HALADQYEEAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGE........... 472
24 -53.4005a31_X mol:protein length:599 ANAPHASE-PROMOTING COMPLEX SUBUNIT 7  ali model follow..  13  269DNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQA---------------LLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLDPVTQEKAKTLLNKALTQEPDYIKAV------------VKKAELLSREQKYEDGIALLRNALANQSD-----CVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQ.. 594
25 -53.3003v6p_A mol:protein length:442 dHax3  ali model follow..  57QQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQALLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQAQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNSGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIA------------SHDGGKQALETVQRLLPVLCQAHGLTPE----QVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQ 418
26 -52.2004i17_A mol:protein length:228 hypothetical protein  ali model follow..  13  5TDPNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNATIEKLYAIY--------YLKEGQKFQQAGNIEKAEENYKHATDVTSKK---WKTDALYSLGVLFYNNGADVLRKATPLASSNKEKYASEKAKA--DAAFKKAVDYLGEAVTLSPNRTEIKQMQDQVKAMIK........................................................................................................................... 228
27 -52.1002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model follow..  12  199.EASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVT---------------WLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVV------------AFNKSDMQTAINHFQNALLLVKKTQSNEAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEE....... 596
28 -51.9004uzy_A mol:protein length:651 FLAGELLAR ASSOCIATED PROTEIN  ali model follow..  14  16.AEGQYTQTIYTLIKEQKFAEAIQHLQYQLQNVPESRAALSLLGYCYYYTGQYDMASQMYEQLVTLYPSNEDYKLYYAQSLYKGGMYPEASKAVVKVEGHQKEQDDLTGCRRQLDKCEDPDTMVNTGCIMFKEGKFEAARQKFNDAVQALGYQPELLYNIALCYYKTKQFGPALKHLAEAVREHPELSVGSNTDGMEVRSVGDPTGGFKKLNFLLQSPPFPPETFANLELATRHVEQLRRLTKQIQDARIARDNDAIKRAINEYDEALEAYIPGLMAMASIYWDMELYSNVEKIFRQSAEFCSEHEVWKLNVAHTFFQDNHYKEAIRYYEPVVKKNADTAIVLANLCVSYIMTSQNEE. 511
29 -51.8002q7f_A mol:protein length:243 YrrB protein  ali model follow..  16  2..................GSSSSGLVPRGSHMASMTGGQQMGRG---SEFGDYEKAAEAFTKAIEENKEDAIPYINFANLLSSVNELERALAFYDKALELDSSAATA---------------YYGAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADA--------------------------------------------------FYNAGVTYAYKENREKALEMLDKAIDIQPDHMLALHAKKLL............................................ 230
30 -51.6004ui9_J mol:protein length:620 CELL DIVISION CYCLE PROTEIN 16 HOMOLOG  ali model follow..  12  128IKSSICLLRGKIYDALDNRTLATYSYKEALKLDVKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLM---------------GHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEV------------GVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSE. 531
31 -51.1004buj_B mol:protein length:1436 SUPERKILLER PROTEIN 3  ali model follow..  13  490..............APKDHNAALKLYDNILSGDFSNIQAKMGKGIIFIERKNWKDAMTLLTQVHEQSPNNLEVLSELSWSKAHMGYMDEALAGLDTVIKGIKGMDLRSIDFRALNLWRQAKVYIMKHASI-KQENVKCAFKLLIQSIKILDTFAPGFSTLGDIYCHYKDHLRAFKCYFKAFDLDAGDYTAAKYITETYASKPNWQAASSIASRLIKGEKAKAELRSNNWPFRVV------GIAHLEKQEESDSIEWFQSALRVDPNDVE----SWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFAQYFKAISLCDVGEYLESLDILEKVCQEAATEESFQIGLVEVLMRCSL.... 823
32 -51.0004ynw_A mol:protein length:339 ACL4  ali model follow..  10  9..............NKSKKSKDRARLKVASSQTSINPKELLDRATTLLEEGDIETAAKVARTAYEHIGENGRALTLLGQIHVELGDIDAARNYYAAAVKVDEDGSLPEELGGGPEKFLWLAQLSE--------EGGHDSVAWFERGATLRAQIQSLMDSLEQRPLSRGQVEAAIADKRRRL-AETLCAVVEVYMTDLSWEDDAEQRCEALITEATMIAPEWPETWQTVANV------------RISQERTEEAREALRRSLGLWTHLPP-PFPSRVSLVRLLIEVDMEEEALEVTERLIAEDDLSVEVWYLGGYARYRLGEKEREASGQASEPEAWKDTWRSSRKWLRQCLKVFEA... 339
33 -50.5002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  18  3TAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPL---------------HLQRGLVYALLGERDKAEASLKQALALED-TPEIRSALAELYLSMGRLDEALAQYAKALEQAPKDLDLRVRYASALLLKGKAEEAARAAA................................................................................................................................................... 209
34 -50.5001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  17  4VEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN---------------------------------QLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVAS........................................................................................................................ 207
35 -50.0004abn_A mol:protein length:474 TETRATRICOPEPTIDE REPEAT PROTEIN 5  ali model follow..  10  75...............QEEMEKTLQQMEEVLGSAQVEAQALMLKGKALNVTPDYPEAEVLLSKAVKLEPELVEAWNQLGEVYWKKGDVTSAHTCFSGALTHCKNKV-------SLQNLSMVLRQLQTDSGDEHSRHVMDSVRQAKLAVQMDVLDGRSWYILGNAYLSLKISQQALSAYAQAEKVDRSNPDLHLNRATLHKYEESYGEALEGFSQAAALDPAWPEPQQREQQLLEF------------LSRLTSLLESKGKTKPKKLQ----SMLGSLRPAHLGPCGDGRYQSASGQKMTLELQPGVNSGTVVLGKVVFSLTTEEKVPFTFGLVDSDGPCYAVMVYNVVQSWGVLIGDS.. 411
36 -49.9003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  15  3.SVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYY------------------WTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDC---------------LEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEEKKKLETDYKKLSSPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKT-LDKILRIEKEVNR....................................................................................................................... 208
37 -49.6003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  18  1.............................MGNDDIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKV---------------ATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVELALVPR................................................................................................................................. 186
38 -48.7003asg_A mol:protein length:186 MamA  ali model follow..  19  1.............................MGNDDIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKV---------------ATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELALVPR................................................................................................................................. 186
39 -48.1004osk_A mol:protein length:499 Hax3  ali model follow..  97QQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNSGGKQALETVQALLPVLCQAHGLTPEQVVAIASNSGGKQALETVQRLLPVLCQAHGLTPQQVVAIASHDGGKQAQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNSGGKQALETVQRLLPVLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIA------------SNGGGKQALETVQRLLPVLCQAHGLTPE----QVVAIASNSGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNSGGRPALESIVA. 457
40 -48.0003vtx_A mol:protein length:184 MamA  ali model follow..  16  2.................................GETTTIYMDIGDKKRTKGDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEA---------------YYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAVKYFKKALEKEEKKA......................................................................................................................................... 175
41 -47.8001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  16  9VEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGN---------------------------------QLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKI------------DKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLAKKD..................................................................................................................... 202
42 -47.3004XNH Entity 1(prereleased)  ali follow..  13  18KKENDQFLEALKLYEGKQYKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKASASPICCHVLGIYMRNTKEYKESIKWFTAALNNGSTNKQI---------------YRDLATLQSQIGDFKNALVSRKKYWEAFLGYRANWTSLAVAQDVNGERQQALSQFEKLAEGKISDSEKYEHKATIYMKLGQLKDASIVYRTLIKRNPDNFKYYKLLEVSLGIQGDNKLKKALYGKEELSKKLREYVLPQLERGQDPIPFIWTNYYLSQHFLFLKDFPKAQEYIDAALDHTPTLVEFYILKARILKHLGLMDTAAGILEEGRQLDLQDRFINCKTVKYFLRANNIDK. 470
43 -47.3003asd_A mol:protein length:200 MamA  ali model follow..  19  1.............................MGNDDIRQVYYEDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKV---------------ATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELALVPR................................................................................................................................. 186
44 -47.2003v6t_A mol:protein length:499 dHax3  ali model follow..  10  98QQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQALLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQAQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNSGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASHDGGKQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPE----QVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTNDHLVALACLGGRPALDAVKK. 492
45 -46.9003mkr_A mol:protein length:291 Coatomer subunit epsilon  ali model follow..  12  7..........KNAFYIGSYQQCINEAQRVKPSSPERDERDVFLYRAYLAQRKYGVVLDEIKPS---SAPELQAVRMFAEYLASHSRRDAIVAELDREMSRSVD-------------VTNTTFLLMAASIYFYDQNPDAALRTLHQGDSLEC-----MAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGKLQDAYYIFQEMADKCSPTLLLLNGQAAC------------HMAQGRWEAAEGVLQEALDKDSGHPE----TLINLVVLSQHLGKPPEVTNRYSQLKDAHRSHPFI----KEYRAKENDFDRLVLQYAPS........................... 291
46 -46.9004hou_A mol:protein length:273 Interferon-induced protein with tetratricopep  ali model follow..  11  1..........................DHQVKDSLEQLRCHF-----TWELSIDDDEMPDLENRVLDQKYSVGIHNLLAYVKHLKGQNEEALKSLKEAENLMQE----------------------------------------EHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISA----YRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGY----IKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQ......................... 273
47 -46.8004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  12  5DKAKLYRNISQRCLRRGSPEEALRYLKEWARHEKNDPEPLYQMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARA---------------YYLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTAAEHFTKVMELERSQDSDEEELALVPRGSS............................................................................................................................................................. 191
48 -46.7005a1v_Q mol:protein length:308 COATOMER SUBUNIT EPSILON  ali model follow..  12  14GEVDELFDVKNA-FYIGSYQQCINEAQRVKLSSPEREERDVFLYRAYLAQRKYGVVLDEIKPS---SAPELQAVRMFAEYLASENQRDSIVLELDREMSRSVD-------------VTNTTFLLMAASIYFHDQNPDAALRTLHQGDGLEC-----MAMTIQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVNLAVGKLQEAYYIFQELADKCSPTLLLLNGQAAC------------HSAQGRWETAEGVLQEALDKDSGHPE----TLINLIVLSQHLGKPPEVTNRYSQLKDAHRAHPFI----KEYQAKENDFDRLAMQYAPSA.......................... 308
49 -46.6004gg4_A mol:protein length:499 Hax3  ali model follow..  10  165EQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQ---------------QVVAIASNIGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIA------------SNGGGKQALETVQRLLPVLCQAHGLTPE----QVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAATNDHLVALACLGGRPAAVKKLE.. 493
50 -44.5004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  16  2...............................ARGGSDLEIDNEGVIEADTDAPQEMGDENAEITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAIL---------------YAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLRE-----VQPRAQKIAEHRRKYERKREEREIK...................................................................................................................................... 175
51 -44.3002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  24  1..AEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEA---------------WYNLGNAYYKQGDYDEAIEYYQKALELDPRS.............................................................................................................................................................................................................. 136
52 -44.3004hnw_A mol:protein length:863 N-terminal acetyltransferase A complex subuni  ali model follow..  13  18KKENDQFLEALKLYEGKQYKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKASASPICCHVLGIYMRNTKEYKESIKWFTAALNNGSTNKQI---------------YRDLATLQSQIGDFKNALVSRKKYWEAFLGYRANWTSLAVAQDVNGERQQALSQFEKLAEGKISDSEKYEHKATIYMKLGQLKDASIVYRTLIKRNPDNFKYYKLLEVSLGIQGDNKLKKALYGKEELSKKLREYVLPQLERGQDPIPFIWTNYYLSQHFLFLKDFPKAQEYIDAALDHTPTLVEFYILKARILKHLGLMDTAAGILEEGRQLDLQDRFINCKTVKYFLRANNIDK. 470
53 -44.0004gco_A mol:protein length:126 Protein STI-1  ali model follow..  21  11ELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLR................................................................................................................................................................................................................................................... 126
54 -44.0002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  12  8..SNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWLCGRLNRPAESMAYFDKALA-------------DPTYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKKYQSRVEVLQADDLLLGWKIAKALGNAQAAYEYEAQLQANPYSEELQTVLT.................................................................................................................................. 223
55 -44.0004cgu_A mol:protein length:112 TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH  ali model follow..  14  3SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEGYD.......................................................................................................................................................................................................................................................... 110
56 -43.9003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  13  2MKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQ............................................................................................................................................................................................................................................. 123
57 -43.7002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  12  10...............PRGSHMGDQNPLKTDKGRDEARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLN---------------NYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQYYDLFAQGGGQNARSLLL-------------GIRLAKVFEDRDTAASYGLQLRLYPGSLEY......................................................................................... 239
58 -43.4002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  11  10..PRGSHMASMTGGQQMGRTSGDQNPLKTDKGRDEARDAYIQLGLGYLQRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLN---------------NYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADLLYKEREYVPARQYYDLFAQGGGQNARSLLL-------------GIRLAKVFEDRDTAASYGLQLRLYPGSLEY......................................................................................... 252
59 -42.8004cgw_A mol:protein length:117 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  26  16QQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP................................................................................................................................................................................................................................................................. 117
60 -42.2002ypf_A mol:protein length:758 AVRBS3  ali model follow..  10  412EQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNIGGKQALETVQALLPVLCQAHGLTPE---------------QVVAIASNIGGKQALETVQALLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQ------------ALETVQRLLPVLCQAHGLTPQ----QVVAIASNGGGKQALETVQRLLPVLCQAAGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQ 739
61 -42.1004zlh_A mol:protein length:339 Lipopolysaccharide assembly protein B  ali model follow..  11  2...................DKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQ---------------ATSEWQKAIDVAERLVKLGKDKAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVS-----------ETLEMLQTCYQQLGKTAEWAEFLQRAVEENTG-----ADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLAEEGRAKESLMVLRDMVGEKVRSKPRYRCQK............ 309
62 -41.8001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  25  2EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEA................................................................................................................................................................................................................................................... 117
63 -41.5004hpz_A mol:protein length:463 dTale2  ali model follow..  10  111GQLLKIAKRGGVTAVEVHHTWRNALTGAPLNLTPDQVVAIASNI-------GGKQALETVQRLLPVLCQDHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTP---------------DQVVAIASHDGGKQALETVQRLLPVLCQDHGLTPQQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNDGGKQALETVQRLLPVLCQDHGLTP------------EQVVAIASNGGGKQALETVQRLLPVLCQ----AHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQDHGLTPAQAVAIANNNGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNGGGKQA 431
64 -41.5002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  18  8DLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQY................................................................................................................................................................................................................................................ 126
65 -41.4001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  21  3.QALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERL............................................................................................................................................................................................................................................ 131
66 -41.0002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  22  13KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNK................................................................................................................................................................................................................................................... 128
67 -40.9004kbq_A mol:protein length:139 E3 ubiquitin-protein ligase CHIP  ali model follow..  19  9PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLN............................................................................................................................................................................................................................................................ 115
68 -40.9003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  20  2KQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILKE................................................................................................................................................................................................................................................ 127
69 -40.8004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  24  12QKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKE............................................................................................................................................................................................................................................. 133
70 -40.7004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  11  2.........................................SHMASMSHLNYLLEKIAASSKEDFPFPDDLESY-----LEGYVPDKNIALDTYQKIFKISSE---------------DLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRK........................................................................................................................... 176
71 -40.7002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  20  10AEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAEL................................................................................................................................................................................................................................................... 125
72 -40.5003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  19  7PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLN............................................................................................................................................................................................................................................................ 113
73 -40.1002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  24  26SSVEQLRKEGNELFKCGDYGGALAAYTQALGLDADQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISG................................................................................................................................................................................................................................................... 144
74 -40.1004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  18  6DAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGREIAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKE....................................................................................................................................................................................................................................................... 124
75 -40.1003pe3_A mol:protein length:723 UDP-N-acetylglucosamine--peptide N-acetylgluc  ali model follow..  12  1............................GPGSCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADA---------------YSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLY-------------PLSHGFRKAIAERHGNLC----LDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMA.......... 289

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.