current user: public




3hsqA
Query: 3hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MKIHPTAIIDPKAELHESVEVGPYSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVIGVMPQDLGFNQQLLTKTVIGDHNIFREYSNIHKGTKEDSPTVIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVVGLNSVGMKRAGFSPEVRNAIKHAYKVIYHSGISTRKALDELEASGNLIEQVKYIIKFFRDSDRGVTNHRLast
1 -122.0003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model  100  1MKIHPTAIIDPKAELHESVEVGPYSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVIGVMPQDLGFNQQLLTKTVIGDHNIFREYSNIHKGTKEDSPTVIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVVGLNSVGMKRAGFSPEVRNAIKHAYKVIYHSGISTRKALDELEASGNLIEQVKYIIKFFRDSDRGVTNHR 259
2 -113.0003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  33  6.KIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDIPQDISYKEEQKSGVVIGKNATIREFATINSGTAKGGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRR-FDKDEVDRLSRAFKTLFRQGDLKENAKNLLENQ--ESENVKKMCHFILETKRGIPVYR 261
3 -111.0001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  35  3.KIAKTAIISPKAEINKGVEIGEFCVIGDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVLGTQPQDLKYKGEY-SELIIGEDNLIREFCMINPGTEGGKKTLIGDKNLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFIRGLNRHRMRQ-LLESKDIDFIYALYKRLFRPIPSLRESAKLELEEHANNPFVKEICSFILESSRGVAYKS 259
4 -107.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  41  9.FVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEP-TRVEIGDRNRIRESVTIHRGTVQGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR.. 264
5 -43.4003fs8_A mol:protein length:273 QdtC  ali model follow..  19  4.NISKSAIIKEGVIIGENVTIEDNVYIDYGCIIRDNVHIKKGSFIGARSILGEYLVDFYNDRINKKHPLIIGENA--HKVTIRENTKIGNNVKIGTLSDIQHHVYIGNYVNIHSNVFVGEKSIIKDFVWLFPHVVLTNDVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREIC------SIRKIKNKITGEQVYPWRYTFKRGMPWEETDYDTWIKNISIENLE................. 267
6 -35.7002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  18  137VCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKH--SVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQ-QVAKVRNLPRLEERIAALEKLVQKLEAL....................................... 364
7 -35.2003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  18  132ASVGAYAVIESGARIGAGVSIGAHCVIGARSVIGEGGWLAPRVTLYHDVTIGARVSIQSGAVIGGEEKGVWQKIAQIGGVTIGDDVEIGANTTIDRGALSD--TLIGNGVKLDNQIMIAHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITPGSYSSGTAMQPAA-SAARIRQLDDMARRLQQLEKRLAAVTSSGDASSDA................................ 366
8 -34.8003eh0_A mol:protein length:341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  19  116VSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDD--TIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITPGVYSSGIPLQPNK-TAALVMNIDDMSKRLKSLERKVNQQ.......................................... 340
9 -30.0003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  23  4ATIHPTAIVDEGARIGAHSRIWHWVHICGGAEIGEGCSLGQNVFVGNRVRIGNR-------------------------------------------------VKIQNNVSVYDNVFLEDDVFCGPSMVFTNRKSEYRDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQIG.................................................................... 154
10 -28.6003TV0 Entity 1(prereleased)  ali follow..  18  6.....AEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIGPIVIGEGNLIEEQALIINAYPD-DTEDPEPKPMIIGTNNVFEVGCYSQAMK-------MGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNY................................................................................ 178
11 -26.3003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  13  27............LSVGKNVLISKKASIPGVISIGNNVRIDDFCILSGKVTIGSYSHIAAYTAL-----------GGEVGIEMYDFANISSRTIVYAAIDD-----------------FSGNALMGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRK...................................................................... 178
12 -26.3003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  18  34.....CIFLDDFKGMKFESTLPKYDFF---IAIGNNEIRKKIYQKISENGFKIVNLIHKSALI-----------SPSAIVEENAGILIMPYVVINAK------AKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKR...................................................................... 197
13 -25.7002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  18  33.....CIFLDDFKGMKFESTLPKYDFF---IAIGNNEIRKKIYQKISENGFKIVNLIHKSALI-----------SPSAIVEENAGILIMPYVVINAK------AKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKR...................................................................... 196
14 -23.1003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  25  106.................................................................................IGDQAVIMMGAILNIG------AVVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKV-------IKQIDDKTKSKTEILEELRKL.......................................... 236
15 -22.3003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  26  92ARIEPGAIIRDHVEIGDNAVIMMNATINIGAVIGEGSMIDMNAVLGGRATVGKNCHVGAGAVLAGVIEPPS-----------------------------------------------------------------AKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARV-------IKEIDEKTKAKTEIKQELRQLNPEK...................................... 240
16 -21.1003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  15  27.......................WSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSI---------RADEGTPFHIGSRTNIQDGVVIHGLQQGRVIGDDGQ----------EYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFN-ARVGAGCVVMMHVLIQDEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNELQ.................... 223
17 -20.3003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  19  4.......................YPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRG----------DVAPTVIGNRVNIQDNSILH--QSPNNPLIIEDG-VTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPP----------------GKKIPPNTLALGRPAKVV---------RELTEDDIREMERIRREYVEKGQYYKALQQQRTSCADKKE.................... 181
18 -20.1001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  19  4.......................YEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRG----------DIEQIYVGKYSNVQDNVSIH--TSHGYPTEIGEY-VTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPP----------------NKEIPDYSLVLGVPGKVV---------RQLTEEEIEWTKKNAEIYVELAEKHIKGRKRI............................ 173
19 -19.2003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  20  21.......................VPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRG----------DVDKIEVGEGTNIQDNTVVH--DSMHGDTVIGKF-VTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPA........................................................................................ 156
20 -19.2001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  19  6.......................YPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRG----------DVSPTIIGDRVNVQDQCTLH--QSPQYPLILEDD-VTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQ----------------GKKIPPNTLAFGRPAKVI---------RELTAEDRKDMERIRTQYVEKGQYYKSLQK.............................. 173
21 -19.2003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  15  9.......................RPYKNLFPGIGQRVMIDTSSVVIGDVRLADDVGIWPLVVIRG----------DVNYVAIGARTNIQDGSVLHVTHKSSSNPH-------------GNPLIIGEDVTVGHKVMLHG-CTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPKRLESGYLYLGSPVKQI---------RPLSDAERSGLQYSANNYVKWKDDYLSQDNHIQ........................... 186
22 -19.0003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  15  105FRVVPPATVRKGAFIARNTVLMPS-YVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGV-----LEPLQANPTIIEDN------------------CFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIY.......................................................................................................................... 217
23 -19.0001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  13  53.......................WNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASI---------RSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGK-EYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFK-SKVGNNCVLEPRSAAIRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKE....................................... 245
24 -19.0003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  16  108FRVVPPAAVRQGAFIARNTVLMPS-YVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGV-----LEPLQANPTIIEDN------------------CFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIY.......................................................................................................................... 220
25 -19.0003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  146FRVVPPAIARRGSFIAKNVVLMP-SYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQ-----------------------------------------------------------------ANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGR-IPAGSVVVAGNLPAKDGTHSLYCAVIVKKVDAKTRAKVGLNELLRGD..................... 316
26 -18.4003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  18  13.......................RTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRG----------DMHHIRIGARTSVQDGSVLHITHASDYNPG-------------GYPLIIGDDVTIGHQAMLHG-CTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSKVLESGFVYMGTPAKKV---------RPITEKERSFFTYGAGNYVRLKDKHLAEGYD............................. 188
27 -18.0001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  17  103FRVVPPATVRQGAFIARNTVLMPS-YVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGV-----LEPLQANPTIIEDN------------------CFIGARSEVVEGVIVEEGSVISMGVYLGQSTRI........................................................................................................................... 214
28 -18.0001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  20  20......................................IKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHM--------KLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEI--------KQRFDQDTINQLLDI.............................................. 179
29 -17.5003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  17  58..................................................NGNNNKLIIEDDVECRWLTVIFRGD-NNYVRIHKNSKIKGDIVATKGSK----VIIGRRTTIGAGFEVVTDVTIGHDCMIARDVILAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKI...................................................................... 213
30 -17.0003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  16  11..................................FSGIPLDQQVTNPNIIVGKHSYYSGYYHGHSFDDCVRYERDDVDKLVIGSFCSIGSGAVF-AGNQGHRSDWISTFPFFYQDNDNFAD--------ARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHI--------KFRFSDVEIAMLLEM.............................................. 177
31 -16.9002f9c_A mol:protein length:334 Hypothetical protein YDCK  ali model follow..  14  97..WIDRADISDGARISDNVTIQSSSVREECAIYGDARVLNQSEILANHSRIVHQVQLYGNATITHA-DFALIEGDKDNNVWICDCAKVYGHARVIAGTEEDAIPTLRYSSQVAEHALIEGNCVLKHHVLVGGHAEVRGGPILDDRVLIEGHACIQGEILIERQVEISGRAAVIAFDDNTIHLRGPKVINGEDRITRTPLVGSLLE...................................................... 328
32 -16.8001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  14  1..........................MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYDRDDVDKLVIGSFCSIGSGAAF-AGNQGHRAEWASTFPFHFMHEEPAFAGAV-------NGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTI--------RKRFSDGDIQNLLEM.............................................. 176
33 -16.3003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  13  131.................................................................................IVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYPYSVVVAGTMPGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD...................... 298
34 -16.2003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  19  286TVIHPGTQLLGRTQIGGRCVVGPDTTL-TDVAVGDGASVVSSSSIGDGAAVGPFTYLRPGTALGADGK-------------LGAFVEVKN-STIGTGTKVPHLTYVGD-------ADIGEYSNIGASSVFVNYDGTSKRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASK.................................................. 477
35 -16.1002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  18  272VEIDVNVIIEGNVKLGDRVKIGTGCVL-KNVVIGNDVEIKPYSVLED-SIVGEKAAIGPFSRL-------RPGAELAAETHVGNFVEIKK-STVGKGSKVNHLTYVGD-------SEIGSNCNIGAGVITCNYDGANKFTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELVITR.......................................................................... 440
36 -16.1001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  17  272VEIDTNVIIEGNVTLGHRVKIGTGCVI-KNSVIGDDCEISPYTVVED-ANLAAACTIGPFARL-------RPGAELLEGAHVGNFVEMKK-ARLGKGSKAGHLTYLGD-------AEIGDNVNIGAGTITCNYDGANKFTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISR.......................................................................... 440
37 -16.1003fww_A mol:protein length:456 Bifunctional protein glmU  ali model follow..  15  272ITIDTNVIIEGHVILGDRVRIGTGCVL-KNCVIGDDSEISPYTVLED-ARLDANCTVGPFARL-------RPGAELAEGAHVGNFVEIKK-ARLGKGSKAGHLSYLGD-------AEIGAGVNIGAGTITCNYDGANKFTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISR.......................................................................... 440
38 -16.1001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  22  53...........................................................FGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVM----LDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARI...................................................................... 178
39 -15.6002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  14  234.NVEDNVKIKGKVIIEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTILVEKNKIGASVEV--------------KESVIMEGSKIPHLSYVGDSVI-AEDVNFGAGTLIANLRFDEKEVKVNVKGKRISSGRRKLGAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFF............................................................................. 399
40 -15.6003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  21  69.......................................................................FHCEFGKTIRIGDHTFINMNVVM----LDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARI...................................................................... 182
41 -15.5001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  19  275VQIEANVILKGQTKIGAETVLTNGTYV-VDSTIGAGAVITNSMIVADGVTVGPYAHIRPNSSLGAQ-------------VHIGNFVEVKG-SSIGENTKAGHLTYIGN-------CEVGSNVNFGAGTITVNYDGKNKYTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGR.......................................................................... 442
42 -15.4001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  19  272VQIEANVTLKGQTKIGAETVLTNGTYV-VDSTIGAGAVITNSMIVADGVIVGPYAHIRPNSSLGAQ-------------VHIGNFVEVKG-SSIGENTKAGHLTYIGN-------CEVGSNVNFGAGTITVNYDGKNKYTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGR.......................................................................... 439
43 -15.4003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  21  71.......................................................................FRCDYGYNIHVGKSFFANFNCVI----LDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKV...................................................................... 184
44 -15.2003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  13  256EEVFASGHMASGAGSASGASVSGYAVIKGDTVIGENVLVSQRAYLDN-AWMGKGSNAQENCYII--------------------NSRLERNCVTAHGG-------------------KIINAHLGDMIFTGFNSFLQGSESSP--------------LKIGDGCVVMPHTIIDLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEV-KRIKRILSENGAFFDGSEGTGHAQKGKNFTFNIIQPYQDGDPRGM.... 478
45 -15.2002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  21  67.......................................................................FRCDYGYNIHVGENFFMNFDGVI----LDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKV...................................................................... 180
46 -15.1003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  17  69.......................................................................IRCDYGYNIHVGENFFANYDCIF----LDVCKIEIGDNVMLAPNVQIYTAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRV...................................................................... 182
47 -14.8001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  19  68.......................................................................VYFSYGSNIHIGRNFYANFNLTI----VDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRV-----------------IREINDRDKHYYFKDYKVESSV............................... 203
48 -14.6003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  21  70.......................................................................FDTDYGWNVKLGKNVYVNTNCYF----MDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV...................................................................... 183
49 -14.3003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  17  162VRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISA--GVVVGDGSDVGGGASIMGT-----LSGGGTHVISIGK------------------------------------RCLLGANSGLG--------------------------ISLGDDCVVEAGLYVTAGTRVTMPDSNSVKALSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHANGVPRGLE........................... 326
50 -14.3002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  15  29................................................TVIGNNNSVYIGNNCKIVSSNIRLKGN-NITLFIADDVELVCSLHSDCSLQIQAKTTMGNGEITIGKISIGKDCMLAHGYEIGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKPNCVIAGSPAKI...................................................................... 188
51 -13.1001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  16  121........................................................................QNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIV----VGETSVIENDVSILQGVTLGGHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVSQDKAAKPAFDMNQYFI.................................................... 259
52 -13.0003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  14  199.................................................................................IGEGTTVMHEGFVNFNAGTEGPGMIE--------GRVSAGVFVGKGSDLGGGCSTMG-ISVGEGCLIGANAGI---IPLGDRNIVEAGLYITAGTKVALLDEQNAKVVKARDLAGQPDLLFRRNSQNGAVECKTN--KTAIELNEALHA............................. 345
53 -12.8001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  18  119........................................................................QNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIV----VGETSVIENDVSILQGVTLGGHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS.................................................................... 241
54 -12.8003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  18  140........................................................................QGRKDFAYYLQSRSSSIFQTDIHPAARLGSGLFLDHATGLV----VGETAVVEDNVSILHGVTLGGHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIGETGCTEPSRVMDQMLGDGI................................................. 281
55 -12.7003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  15  126........................................................................QDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIV----IGETAVVENDVSILQSVTLGGHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVG.................................................................... 248
56 -12.6001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  18  133........................................................................QGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHATGIV----VGETAVIENDVSILQSVTLGGHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVG.................................................................... 255
57 -12.0002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  13  214...........................................................................PEDNTRILESSKVRMGASLAAGTT--GASYVNFNAGTMVEGRISSSAIVGEGSDVGGGASILG-ISVGKACLLGANSVT---IPLGDNCIVDAGIAVLEGTKFLLKDAEELAKLNP.................................................................... 340
58 -11.5003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  25  180.......FITEMAHSETGIDIHPGAQIGHHFTIDHGT----GVVIGATSIIGNNVKLYQGVTLGAKSFPLDNNGNPIK--------------------------------------GIPRHPILEDDVIVYSNATILGRVT------------------IGKGATVGGNIWVTENVPAGSRIVQRKNKDEL.................................................................... 303
59 -11.0003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  19  155.......EMMESVHSYTSIDIHPGASIKGHFFIDHGV----GVVIGETAIIGEWCRIYQSVTLGA----MHFQEEGGVIKRGTKRH------------------------------------TVGDYVTIGTGAKVLGNII------------------VGSHVRIGANCWIDRDVDS-VYISEHPTHFVK.................................................................... 279

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]