current user: public




Query: 3hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MKIHPTAIIDPKAELHESVEVGPYSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVIGVMPQDLGFNQQLLTKTVIGDHNIFREYSNIHKGTKEDSPTVIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVVGLNSVGMKRAGFSPEVRNAIKHAYKVIYHSGISTRKALDELEASGNLIEQVKYIIKFFRDSDRGVTNHRLast
1 -114.0003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model  100  1MKIHPTAIIDPKAELHESVEVGPYSIIEGNVSIQEGTIIEGHVKICAGSEIGKFNRFHQGAVIGVMPQDLGFNQQLLTKTVIGDHNIFREYSNIHKGTKEDSPTVIGNKNYFMGNSHVGHDCILGNNNILTHGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPSTVVGLNSVGMKRAGFSPEVRNAIKHAYKVIYHSGISTRKALDELEASGNLIEQVKYIIKFFRDSDRGVTNHR 259
2 -110.0005dem_A mol:protein length:258 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  41  3.LIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPTKIGKHNRIYQFSSVGEDTPDLKYKGEP-TRLVIGDHNVIREGVTIHRGTVQDAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRRRGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQSATRGITR.. 258
3 -108.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  41  9.FVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLKSHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEP-TRVEIGDRNRIRESVTIHRGTVQGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR.. 264
4 -106.0004r36_A mol:protein length:275 Putative acyl-[acyl-carrier-protein]--UDP-N-a  ali model follow..  38  15.MISPLAYIHPEAKIGENVEIAPFVYIDRNVVIGDNNKIMANANILYGSRIGNGNTIFPGAVIGAIPQDLKFKGEE-STAEIGDNNLIRENVTINRGTAAKGRTIVGNNNLLMEGVHVAHDALIGNGCIVGNSTKMAGEIIIDDNAIISANVLMHQFCRVGGYVMIQGGCRFSKDIPPYIIAGREPIAYSGINIIGLRRRGFSNEIIENIHNAYRIIYQSGLNTSDALTKVEAEVPASPEIEYIVDFIRNSERGIIR.. 269
5 -105.0001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  35  3.KIAKTAIISPKAEINKGVEIGEFCVIGDGVKLDEGVKLHNNVTLQGHTFVGKNTEIFPFAVLGTQPQDLKYKGEY-SELIIGEDNLIREFCMINPGTEGGKKTLIGDKNLLMAYVHVAHDCVIGSHCILANGVTLAGHIEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFIRGLNRHRMRQ-LLESKDIDFIYALYKRLFRPIPSLRESAKLELEEHANNPFVKEICSFILESSRGVAYKS 259
6 -105.0003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  33  6.KIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSDTTIGDHSRVFSYAIVGDIPQDISYKEEQKSGVVIGKNATIREFATINSGTAKGGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGIRRR-FDKDEVDRLSRAFKTLFRQGDLKENAKNLLENQ--ESENVKKMCHFILETKRGIPVYR 261
7 -104.0004e6t_A mol:protein length:294 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  36  32.LIHSTAIIDPSAVIASDVQIGPYCIIGPQVTIGAGTKLHSHVVVGGFTRIGQNNEIFQFASVGEVCQDLKYKGEE-TWLEIGNNNLIREHCSLHRGTVQDALTKIGSHNLLMVNTHIAHDCIVGDHNIFANNVGVAGHVHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVPAYVMASGNPAHAFGINIEGMRRKGWSKNTIQGLREAYKLIFKSGLTSVQAIDQIKSEIPSVPEAQLLIDSLEQSERGIVR.. 288
8 -103.0004eqy_A mol:protein length:283 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  39  18.RIHPTAIIEPGAQLHETVEVGPYAIVGSNVTIGARTTIGSHSVIEGHTTIGEDNRIGHYASVGGRPQDMKYKDEP-TRLVIGDRNTIREFTTIHTGTVQDGVTTLGDDNWIMAYVHIGHDCRVGSHVVLSSNAQMAGHVEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIPPFVIAAGNKAEPHGINVEGLRRRGFSPDAISALRSAYRILYKNSLSLEEAKVQLSELAQADAAVKALVDFVESSQRGIIR.. 277
9 -98.2003t57_A mol:protein length:305 UDP-N-acetylglucosamine O-acyltransferase dom  ali model follow..  33  10..IHPSAVVHPNAVIGKGVSVGPYCTIGSSVKLGNGCKLYPSSHVFGNTELGENNIIGHHAVVGVKCQDLKYKHGDECFLCIGNNNEIREFCSIHRSSKPSDKTVIGDNNLIMGSCHIAHDCKIGDRNIFANNTLLAGHVVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRNGFTMSEMKSLRAAYRKIFMSTETVSLSFEERLTELEQDQELQSIRDSFTESRRGICKFR 298
10 -28.7002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  18  121..IHPTAVIHPTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPGAVIGSCAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRF--KHSVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPA----RPYQEIHRQVAKVRNLPRLEERIAALEKLVQKLEALSEQ............................. 367
11 -28.0004ihf_A mol:protein length:348 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acy  ali model follow..  20  101..IAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIGYANDRGNWVKIPQIRVIIGDRVEIGACTTIDRGALDD--TIIGNGVIIDNQCQIAANVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITPGVYSSGIPLQPNK-TAALVMNIDDMSKRLKSLERKVNQQ.......................................... 341
12 -27.9003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  22  116..IHPTAIVAADAEVDPSASVGAYAVIESGARIGAGVSIGAHCVIGARSVIGEGGWLAPRVTLGFANEKGVWQKIAQIGVTIGDDVEIGANTTIDRGALSD--TLIGNGVKLDNQIMIAHNVQIGDHTAMAACVGISGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITPGSYSSGTAMQPAA-SAARIRQLDDMARRLQQLEKRLAAVTSSGDASSDA................................ 366
13 -27.1003fs8_A mol:protein length:273 QdtC  ali model follow..  21  2.....PNNISKSAIIKEGVIIGENVTIEDNVYIDYGCIIRDNVHIKKGSFIGARSILGEYLVDFYNDRINKKHP-----LIIGENALIRTENVIYGDTIIGDNFQTGHKVTIRENTKIGNNVKIGTLSDIQHHVYIGNYVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREIC--------RKIKNKITGEQVYPWRYTFKRGMPWEET................................ 252
14 -27.0004e75_A mol:protein length:357 UDP-3-O-acylglucosamine N-acyltransferase  ali model follow..  18  105..IESTARIHPSAVISETAYIGHYVVIGENCVVGDNTVIQSHTKLDDNVEVGKDCFIDSYVTIGFAPYQGKWH-AQLGSVLIGNDVRIGSNCSIDRGALDN--TILEDGVIIDNLVQIAHNVHIGSNTAIAAKCGIAGSTKIGKNCILAGACGVAGHLSIADNVTLTGMSMVTKNISAGTYSSGTGLFENN-KKTIVRLRQLADVPLTQITKRLDHIQAQIESLESTFNL............................. 356
15 -26.1005adx_U mol:protein length:190 DYNACTIN 5  ali model follow..  19  9VKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEA---------GPIVIGEGNLIEEQALIINAHPD-DAEDSEPKPMIIGTNNVFEVGCYSQ-------AMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNY................................................................................ 174
16 -26.0003tv0_A mol:protein length:194 Dynactin subunit 6  ali model follow..  19  13VKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEA---------GPIVIGEGNLIEEQALIINAYPDNITPDTEDPEMIIGTNNVFEVGCYSQ-------AMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNY................................................................................ 178
17 -23.2005afu_U mol:protein length:168 DYNACTIN  ali model follow..  21  1....PGAVVCVESEIRGDVTIGPRTVIHPKARIIAEA---------GPIVIGEGNLIEEQALIINAYPD-NITPDTEKPMIIGTNNVFEVGCYSQ-------AMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYG............................................................................................................. 129
18 -23.1004m98_A mol:protein length:208 Pilin glycosylation protein  ali model follow..  27  94..IHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVD-------------------------------------------------------------------------HDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPDGMTVAGNPAKP...................................................................... 207
19 -22.9003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  24  6..IHPTAIVDEGARIGAHSRIWHWVHICGGAEIGEGCSLGQNVFVGNRVRIGNRVKIQNNVSVNVFLEDDVFCGPSMVFTNVYNPRAAIERKSEYRDTIVRQGATLG-----------------------ANCTVVCGA-------------------TIGRYAFVGAGAVVNKDVPDFALVVGVPARQIG.................................................................... 154
20 -22.9003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  13  27............LSVGKNVLISKKASIPGVISIGNNVRIDDFCILSGKVTIGSYSHIAAYTALYGGEVG----------IEMYDFANISSRTIVYAAIDD-----------------FSGNALMGPTIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRK...................................................................... 178
21 -22.6004m9c_A mol:protein length:216 Bacterial transferase hexapeptide (Three repe  ali model follow..  25  94....................QSTNTVILDEVEIGEGSLLCPFTCLTSNIKIGKFFHANIYSYVA-------------------------------------------------------HDCVIGDYVTFAPGAKCNGNIHIEDHAYIGTGAVIKQ-LIIGKGAIVGMGAVVTKSVPAGVTVVGNPARI...................................................................... 212
22 -22.4002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  28  81..IHKSALISPSAIV----------------EENAGILIMPYVVINAKAKIEKGVILNTSSVIE-------------------------------------------------------HECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKR...................................................................... 196
23 -22.2003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  28  82..IHKSALISPSAIV----------------EENAGILIMPYVVINAKAKIEKGVILNTSSVIE-------------------------------------------------------HECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDEKGVFVGVPAKR...................................................................... 197
24 -21.9004ea7_A mol:protein length:220 Perosamine N-acetyltransferase  ali model follow..  30  102..IHPSAVVSPSVRLGEGVAVMAGVAINADSWIGDLAIINTGAVVD-------------------------------------------------------------------------HDCRLGAACHLGPASALAGGVSVGERAFLGVGARVIPGVTIGADTIVGAGGVVVRDLPDSVLAIGVPAKIKGDR.................................................................. 219
25 -19.0004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  21  2..IHKLADVQ-SQNIGDNTKVWQFCVILAGAVIGRNCNICANSLIEND-------------------------------VVIGDNVTIKSGVQIWDG------------------IHIQDDVFIGPNVTFTNDKQPRSKIYVKKGASIGANSTILPGILIGENAMVGAGAVITKNVPDNAIVIGNPGRITG.................................................................... 148
26 -18.2003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  19  4.......................YPYKGKTPQIAASAFIADYVTITGDVVIGEETSIWFNTVIRGD----------VAPTVIGNRVNIQDNSILH--QSPNNPLIIEDG-VTVGHQVILHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPP----------------GKKIPPNTLALGRPAKVV---------RELTEDDIREMERIRREYVEKGQYYKALQQQRTSCADKKE.................... 181
27 -18.2003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  15  27.......................WSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSI---------RADEGTPFHIGSRTNIQDGVVIH----------GLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFN-ARVGAGCVVMMHVLIQEIPPGKYVPSGMVITTQQ-----------QADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNELQ.......... 223
28 -17.9003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  26  92ARIEPGAIIRDHVEIGDNAVIMMNATINIGAVIGEGSMIDMNAVLGGRATVGKNCHVGAGAVLAGVIEPPS-----------------------------------------------------------------AKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARV-------IKEIDEKTKAKTEIKQELRQL.......................................... 236
29 -17.8004mfg_A mol:protein length:168 Putative acyltransferase  ali model follow..  19  6.......................RDYLEDKPLIDESVFVAKSADVIGNVKIGKDSSIWYNAVVRGD----------EGPITIGENTNIQDCSIV----------------------HGDTETIIGNNVTVGHRSIVHG-CKISDNVLIGMGSIILDNAEIGEYTLIGAGTLITKKFPPGVLIMGSPGKVRELTEEDKKYIDESYEWYLEAAQNQK............................................ 167
30 -17.7003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  20  25...........................GVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGD----------VDKIEVGEGTNIQDNTVVH--DSMHGDTVIGKF-VTIGHSCILHACTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTR----------------GKIVKSGELWAGRPAKLRMMTEEEILYLQKSAENYIALSRGY............................................. 184
31 -17.7003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  24  92ARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGGRATVGKHCHIGAGTVLAGVIEPPS-----------------------------------------------------------------AAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKV-------IKQIDDKTKSKTEILEELRKL.......................................... 236
32 -17.5001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  19  4.......................YEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIE----------QIYVGKYSNVQDNVSIH--TSHGYPTEIGEY-VTIGHNAMVHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPP----------------NKEIPDYSLVLGVPGKVV---------RQLTEEEIEWTKKNAEIYVELAEKHIKGRKRI............................ 173
33 -17.2001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  19  6.......................YPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGD----------VSPTIIGDRVNVQDQCTLH---QSPQYPLILEDDVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQ----------------GKKIPPNTLAFGRPAKVI---------RELTAEDRKDMERIRTQYVEKGQYYKSLQK.............................. 173
34 -16.9001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  13  50....................VTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASI---------RSDEGMPIFVGDRSNVQDGVVLH-ALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFK-SKVGNNCVLEPRSAAIRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKE....................................... 245
35 -16.4003tio_A mol:protein length:183 Protein YrdA  ali model follow..  15  13...............................QIGQRVMIDDSSVVIGDVRLADDVGIWPLVVIRGD----------VHYVQIGARTNIQDGSMLHSSYNPDGNPLTIGEDVTVGHKVMLHGCTIGNRVLVGMGSILLDGAIVEDDVMIGAGSLVPQ----------------NKRLESGYLYLGSPVKIRPLSDEEKAGLRYSANNYVKWKDEYL............................................ 175
36 -16.3003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  14  17...........................GISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGD----------MHHIRIGARTSVQDGSVLHDYNPGGYPLIIGDD-VTIGHQAMLHGCTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSP----------------GKVLESGFVYMGTPAKVRPITEKERSFFTYGAGNYVRLKDKHL............................................ 183
37 -16.2003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  14  17...............................GIGQRVMIDTSSVVIGDVRLADDVGIWPLVVIRGD----------VNYVAIGARTNIQDGSVLHSSSNPHGNPLIIGEDVTVGHKVMLHGCTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPQ----------------HKRLESGYLYLGSPVKIRPLSDAERSGLQYSANNYVKWKDDYL............................................ 179
38 -16.0003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  17  59...................................................GNNNKLIIEDDVECRWLTVIFRGD-NNYVRIHKNSKIKGDIVATKGS----KVIIGRRTTIGAGFEVVTDVTIGHDCMIARDVILDGHIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKIIKRNIIWARTD........................................................... 224
39 -15.5005adx_V mol:protein length:165 DYNACTIN SUBUNIT 6  ali model follow..  16  1..................................SGNKVSRQSVLCGSQNINGKTIVMNDCIIRGD----------LANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVV-------NAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETV----VPPFTVFSGCPGLFS---------GELPECTQELMIDVTKSYYQKFLPLTQV................................ 165
40 -14.9001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  23  53...........................................................FGQVTEAYIEPTFRCDYGYNIFLGNN-----FANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARI...................................................................... 178
41 -14.4003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  21  69.......................................................................FHCEFGKTIRIGDHTFINMNVVM----LDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARI...................................................................... 182
42 -14.4003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  14  17........................................DQQVTNPNIIVGKHSYYSGYYHGHSFDDCVRYLHPERDDV---DKLVIGSFCSIGSGAV---FMMAGNQGHRSDWISTFPFFYQDND--ARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHI--------KFRFSDVEIAMLLEM.............................................. 177
43 -14.3003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  20  54......................................................NQLLGSSADGKAQINPDFRCDYGYNIHVGKS-----FANFNCVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKV...................................................................... 184
44 -14.2004n27_A mol:protein length:195 Bacterial transferase hexapeptide repeat  ali model follow..  20  15MPIYAYNGHKPQFADRESNWIAPDATLIGKVVVGENAGFWFGAVLRG----------------------------DNEPITIGADTNVQEQTIMH--TDIGFPLTIGAG-CTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKE----------------GMEIPDNSLVVGSPARVL---------RQLDDAAVEKLRASAKHYVERGHSFMRGME.............................. 187
45 -14.1003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  17  66....................................................................EQNIRCDYGYNIHVGEN-----FANYDCIFLDVCKIEIGDNVMLAPNVQIYTAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRV...................................................................... 182
46 -14.1002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  20  64....................................................................EPNFRCDYGYNIHVGEN-----FMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKV...................................................................... 180
47 -14.0001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  16  15........................................SEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDV---DKLVIGSFCSIGSGAA---FIMAGNQGHRAEWASTFPFHFMHEE--AVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPARTI--------RKRFSDGDIQNLLEM.............................................. 176
48 -13.8001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  23  17.....VQFIKPILEKLENVEVGEYSYYDSNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNG---------------------------------------EKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEI--------KQRFDQDTINQLLDI.............................................. 179
49 -13.7002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  16  32...................................................GNNNSVYIGNNCKIVSSNIRLKGN-NITLFIADDV---EIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEISIGKDCMLAHGYEIDMHVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKPNCVIAGSPAKIVKENIVWGRK............................................................ 198
50 -13.6004hur_A mol:protein length:220 Virginiamycin A acetyltransferase  ali model follow..  20  21...NRNLQFIKPTITNENILVGEYSYYDSKRG--EDQVLYHYEVIGDKLIIGRFCSIGPGTTFIMNGANHRMDGSTYPFHLFRMG---------------------------------------EKYMPSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVAPYSIVGGNPLKFI--------RKRFSDGVIEEWLAL.............................................. 185
51 -13.6001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  19  65....................................................................EPPVYFSYGSNIHIGRN-----YANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRV-----------------IREINDRDKHYYFKDYKVESSV............................... 203
52 -13.3003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  21  67....................................................................SIPFDTDYGWNVKLGKN-----YVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDNDLPSETLNDETIK................................................... 202
53 -13.3004fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  17  275ITIDTNVIIEGHVILGDRVRIGTGCVL-KNCVIGDDSEISPYTVLED-ARLDANCTVGPFARL-------RPGAELAEGAHVGNFVEIKK-ARLGKGSKAGHLSYLGD-------AEIGAGVNIGAGTITCNYDGANKFTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELV----SRVKQVHIQGWKR............................................................ 454
54 -13.3002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  19  272VEIDVNVIIEGNVKLGDRVKIGTGCVL-KNVVIGNDVEIKPYSVLED-SIVGEKAAIGPFSRL-------RPGAELAAETHVGNFVEIKK-STVGKGSKVNHLTYVGD-------SEIGSNCNIGAGVITCNYDGANKFTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELV----TRVAQRHIQGWQR............................................................ 451
55 -13.3001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  18  272VEIDTNVIIEGNVTLGHRVKIGTGCVI-KNSVIGDDCEISPYTVVED-ANLAAACTIGPFARL-------RPGAELLEGAHVGNFVEMKK-ARLGKGSKAGHLTYLGD-------AEIGDNVNIGAGTITCNYDGANKFTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALA----SRVPQTQKEGWRR............................................................ 451
56 -13.2004egg_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  23  64....................................................................SIPFDTDYGWNVKLGKN-----YVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV...................................................................... 180
57 -13.2004dcl_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  23  64....................................................................SIPFDTDYGWNVKLGKN-----YVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKV...................................................................... 180
58 -13.1003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  17  266.....VTVVDPAT-----------TWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTL-AVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGANSTIGTGTKVPHLTYVGDADIGEYSNIGASSVTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASK.................................................. 477
59 -12.7001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  17  255.....VSFVNPEA-----------TYIDIDVEIAPEVQIEANVILKGQTKIGAETVLTNGTYVSTIGAGAVITNSMIEESSVADGVTVGPYAHIRPNSSLGAQVHIGNGSSIGENTKAGHLTYIGNCEVGSNVNFGAGTIVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIA----GRGRQINKDEYATR........................................................... 454
60 -12.6001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  18  252.....VSFVNPEA-----------TYIDIDVEIASEVQIEANVTLKGQTKIGAETVLTNGTYVSTIGAGAVITNSMIEESSVADGVIVGPYAHIRPNSSLGAQVHIGNGSSIGENTKAGHLTYIGNCEVGSNVNFGAGTIVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIA----GRGRQINKDEYATR........................................................... 451
61 -12.4002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  16  234.NVEDNVKIKGKVIIEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTILVEKNKIGASVEV--------------------------KESVIMEGSKIPHLSYVGDS--------IAEDVNFGAGTLIANKVNVKGKAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFF............................................................................. 399
62 -12.1001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  23  140.......................................................................................IHPAAKIGHGIMFDHATGI-----------VGETSVIENDVSILQGVTLGGHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS.................................................................... 241
63 -12.1001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  23  142.......................................................................................IHPAAKIGHGIMFDHATGI-----------VGETSVIENDVSILQGVTLGGHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAGVPARIVS.................................................................... 243
64 -12.0004n69_A mol:protein length:286 Serine Acetyltransferase Apoenzyme  ali model follow..  28  155.......................................................................................IHPAARIGKGILFDHATGV-----------VGETAVIGNNVSILHHVTLGGHPKIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVPPRTTAVGNPARLVG.................................................................... 256
65 -12.0003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  21  147.......................................................................................IHPAATIGCGIMLDHATGI-----------IGETAVVENDVSILQSVTLGGHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVG.................................................................... 248
66 -11.9004h7o_A mol:protein length:281 Serine acetyltransferase  ali model follow..  22  144.......................................................................................IHPAARIGRGIMLDHATGI-----------IGETAVVEDDVSILQDVTLGGHPKIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVG.................................................................... 245
67 -11.9004hzd_A mol:protein length:282 CysE, serine acetyltransferase  ali model follow..  23  154.......................................................................................IHPAARLGSGLFLDHATGL-----------VGETAVVEDNVSILHGVTLGGHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIG.................................................................... 255
68 -11.8001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  23  154.......................................................................................IHPAAKIGRGIMLDHATGI-----------VGETAVIENDVSILQSVTLGGHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVG.................................................................... 255
69 -11.8003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  23  161.......................................................................................IHPAARLGSGLFLDHATGL-----------VGETAVVEDNVSILHGVTLGGHPKIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVPHNVTVAGVPARIIG.................................................................... 262
70 -10.2003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  21  180.......FITEMAHSETGIDIHPGAQIGHHFTIDHGT-----VVIGATSIIGNNVKLYQGVTLGAKSFPLDNNGNPIKGIP---HPILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSRIVQRK............................................................................................................................... 298
71 -10.2002f9c_A mol:protein length:334 Hypothetical protein YDCK  ali model follow..  10  67.MAFAGTEITGNARITQPCTLYNNVRIGDNVWIDRSSSVREECAIYGDARVLNQSEILAIQGLTHEHAQILQIYDRATVNHNATITHAFIEHRAEVFDFALIEGDKDNNVWICDCAKVYGHARVIAGTEEDAIPTLRYSSQVAEHALIEGNCVLKHHVLVGGHAEVRGGPILLDD.................................................................................... 267
72 -10.1001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  19  103FRVVPPATVRQGAFIARNTVLMP-SYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPL-----------------------------QANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRE-----TGEIHYGRVPAGSVVVSGNLPSKD.................................................................................... 242
73 -10.1003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  18  105FRVVPPATVRKGAFIARNTVLMP-SYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPL-----------------------------QANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRE-----TGEVHYGRVPAGSVVVSGNLPSKD.................................................................................... 244
74 -10.1003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  18  108FRVVPPAAVRQGAFIARNTVLMP-SYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPL-----------------------------QANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRE-----TGDIHYGRVPAGSVVVSGNLPSKD.................................................................................... 247
75 -10.0003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  124FRAVPNCIVRHSAYIAPNAILMP-SFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPM-----------------------------QAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRAT--------------FYGEVPPYSVVVAGTMPGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLR............................................ 297

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.