current user: public




3h70A
Query: 3h70_A mol:protein length:343 O-succinylbenzoic acid (OSB) synthetase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MSLKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHETIASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVAYGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQDFTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVVVLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGYYFEQDVVAHSGILKEGRLEFRPPLVDITQLQPYEGLast
1 -113.0003h70_A mol:protein length:343 O-succinylbenzoic acid (OSB) synthetase  ali model  100  1MSLKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHETIASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVAYGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQDFTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVVVLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGYYFEQDVVAHSGILKEGRLEFRPPLVDITQLQPYEG 337
2 -86.5001wue_A mol:protein length:386 mandelate racemase/muconate lactonizing enzym  ali model follow..  22  9.HMNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQLIPLLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKKSLTEFFGPTEDLPQLLKQVQLAVEKGYQRVKLKIRPGDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFAADDDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFSFPGDISATYFYEDIITEPFILEQGTMTVPQLGIGVTLSQT... 364
3 -84.9001wuf_A mol:protein length:393 hypothetical protein lin2664  ali model follow..  21  9.HMYFQKARLIHAELPLLAPFKTSYGELKSKDFYIIELINEEGIHGYGELEAFPLPDYTEETLSSAILIIKELLPLLAQRKIRKPEEIQELFSWIQGNEMAKAAVELAVWDAFAKRSLAKMIGATQNVETLLQLVNQYVDQGYERVKLKIAPNDIQFVEAVRKSFPKLSLMADANSAYNREDFLLLKELDQYDLEMIEQPFGTKDDHAWLQKQLKTRICLDENIRSVKDVEQAHSIGSCRAINLKLARVGGMSSALKIAEYCALNEILVWCGGMLEAGVGRAHNIALAARNEFVFPGDISASFFAEDIVTPAFELNQGRLKVPTEGIGVTLDLK... 364
4 -84.6002zc8_A mol:protein length:369 N-acylamino acid racemase  ali model follow..  23  1..MRIEAAELRILELPLKFRFETSFGVQTKRTILLLRL-FGEGLEGLGEGVMERLPLYREETVAGARYLLEEFLPRVLGRDLPNPEALREALAPFRGNPMAKAVLEMAFFDLWAKRPLWQVLGGVPSVEDTLRVVERHLEEGYRRIKLKIKPGDYEVLKAVREAFPEATLTADANSAYSLANLAQLKRLDELRLDYIEQPLAYDDDHAKLQRELSTPICLDESLTGAEKARKAIELGAGRVFNVKPARLGGHGESLRVHALAESAGIPLWMGGMLEAGVGRAHNLHLATLPGFTKPGDVSSAYWEEDIVEEALEAKDGLMPVPEVGIGVHLKLP... 354
5 -83.6001sja_A mol:protein length:368 N-acylamino acid racemase  ali model follow..  22  1..MKLSGVELRRVQMPLVAPFRTSFGTQSVRELLLLRAVTPAG-EGWGECVTMAGPLYSSEYNDGAEHVLRHLIPALLAAEDITAAKVTPLLAKFKGHRMAKGALEMAVLDAELRRSFAAELGSVDTIPQLLDVVGGYLDEGYVRIKLKIEPGDVEPVRAVRERGDDVLLQVDANTAYTLGDAPQLARLDPFGLLLIEQPLEEEDGHAELARRIQTPICLDESIVSARAAADAIKLGAVQIVNIKPGRVGGYLEARRVHDVCAAHGIPVWCGGMIETGLGRAANVALASLPNFTLPGDTSASRFYKTDITEPFVLSGGHLPVPTPGLGVAPIPE... 354
6 -83.1003qld_A mol:protein length:388 Mandelate racemase/muconate lactonizing prote  ali model follow..  21  1..MSLQTCVLHRLSLPLKFPMRTAHGHIREKQAILVQLVDADGIEGWSECVALAEPTYTEECTDTAWVMLVHLVPRFARWLRAASQDQCEALRDVRGNRMSVAAIEMAVWDWYAAQPLVGLLGGGESLDVLIQSVDAAVEQGFRRVKLKIAPGDRAAIKAVRLRYPDLAIAADANGSYRPEDAPVLRQLDAYDLQFIEQPLPEDDDLAKLQASLRTPVCLDESVRSVRELKLTARLGAARVLNVKPGRLGGFGATLRALDVAGEAGMAAWVGGMYETGVGRVHGLIAAALPLYATDLGPSDRYFEQDVLKEPIAVEPGVIQVPQAGVADWVDRD... 363
7 -82.0001r0m_A mol:protein length:375 N-acylamino acid racemase  ali model follow..  23  8..FKIEAAEIVVARLPLKFRFETSFGVQT-HKVVPLLILHGEGVQGVAEGTMEARPMYREETIAGALDLLRGFLPAILGQTFANPEAVSDALGSYRGNRMARAMVEMAAWDLWARVPLGTLLGGHADEQATVDLVRRHVEQGYRRIKLKIKPGDVQPVRATREAFPDIRLTVDANSAYTLADAGRLRQLDEYDLTYIEQPLAWDDDHAELARRIRTPLCLDESVASASDARKALALGAGGVINLKVARVGGHAESRRVHDVAQSFGAPVWCGGMLESGIGRAHNIHLSTLSNFRLPGDTASRYWERDLIQEPLEAVDGLMPVPQPGTGVTLDRE... 361
8 -82.0003ik4_A mol:protein length:365 Mandelate racemase/muconate lactonizing prote  ali model follow..  16  3LPTTIQAISAEAINLPLTEPFAIASGAQAVAANVLVKVQLADGTLGLGEAAPFP--AVSGETQTGTSAAIERLQSHLLGADVRGWRKLAAMLDHEHEAAAARCGLEMAMLDALTRMPLHVFFGGAGDEVHAAASAKAILARGIKSIKVKTAAYDLARLRAIHQAAPTAPLIVDGNCGYDVERALAFCKAESIPMVLFEQPLPREDGMAQVTAQSGFAVAADESARSAHDVLRIAREGTASVINIKLMK-AGVAEGLKMIAIAQAAGLGLMIGGMVESILAMSFSANLAAGNGGFDFIDLDTPFIAEHPFIGGFAQTGGTLQLADAGHGVNLEG.... 359
9 -80.6003mwc_A mol:protein length:400 Mandelate racemase/muconate lactonizing prote  ali model follow..  19  6.SARIDGVSLYEIVIPMKIPFQISSGTCYTRRSLVVEIR-EGDLFGYGESAPFEEPFYLGETLETTKVILKNLLPMILGKEPLSIEEFNHLIKNIRGNHFARCGVENAYWDLIAKISLKAMIEKKGRIETLIHQVEESLQEGYRRIKIKIKPGDVEPLQETRRAGDHFPLWTDANSSFELDQWETFKAMDAAKCLFHEQPLHYEADLKELGERIETPICLDESLISSRVAEFVAKLGISNIWNIKIQRVGGLLEAIKIYKIATDNGIKLWGGTMPESGLGARFLISLASFRGFVFPADVAASWYGKGNDLVENTMTDGKIYVPDPGASFDMTLS... 377
10 -80.5001jpd_X mol:protein length:324 L-Ala-D/L-Glu Epimerase  ali model follow..  16  2..SHMRTVKVFEEAWPLHTPFVIARGSRSEARVVVVELE-EEGIKGTGECTPYP---RYGESDASVMAQIMSVVPQLE------KGLTREELQKILPAGAARNALDCALWDLAARRQQQSLTVVIGTPDQMANSASTLWQAGAKLLKVKLDNHISERMVAIRTAVPDATLIVDANESWRAEGLAACQLLADLGVAMLEQPLPAQDDAALENFIHPLPICADESCHTRSNLKALKG--RYEMVNIKLDKTGGLTEALALATEARAQGFSLMLGCMLCTSRAISAALPLVPQVSF---ADLDGPTWLAVDVEPALQFTTGELHL............... 324
11 -79.9003gc2_A mol:protein length:323 o-succinylbenzoate synthase  ali model follow..  19  1.SNAMRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLR-DGEREGWGEISPLPG--FSQETWEEAQTALLTWVNDWL-----------QGSEGLPEMPSVAFGASCALAELTGVLPEAADPLCTGDPDDLVLRLADM--PGEKIAKVKVGVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKAQQVNPDYRARIAFLEEPCKTRDDSRAFARETGIAIAWDESLREADFTFEAEE--GVRAVVIKPTLTGSLDKVREQVAAAHALGLTAVISSSIESSLGLTQLARIAAWLTPGTLPGLDTLHLMQAQQIRPWPGSALPCLKREELERL........ 322
12 -79.7003fcp_A mol:protein length:381 L-Ala-D/L-Glu epimerase, a muconate lactonizi  ali model follow..  15  3LTATVEQIESWIVDVPTIRPHKLSMTTMGCQSLVIVRLTRSDGICGIGEATTIGGLSYGVESPEAISSAITHYLPLLKGQPADNLNALTARMNGIKGNTFAKSAIETALLDAQGKLPVSALLGGADTAKDIAEGEKLLAEGRHRAFKLKIGATDLRHTRAIVEAGDRASIRVDVNQAWDAATGAKGRELAAMGVDLIEQPVSAHDALVRLSQQIETAILADEAVATAYDGYQLAQQGFTGAYALKIAKAGGPNSVLALARVAQAAGIGLYGGTMLEGTVGTVASLHAWSTLPLQWGTEMFGPLLKDDIVSVPLTFADGQVALPQPGLGVELDED... 365
13 -79.6002pge_A mol:protein length:377 MenC  ali model follow..  18  1.SLSGMELSYRRSDLIFKRPAGTSRGVLTSKPTWFVRLD-IDGHGGQGEVSLIPG--LSLDPEEQIGRELDLLLAERGGADFSDYRSVLTDIAGIGRFPALRFALEMALLDLLSGGRQEWFLIWMGEAAFMQEQIEAKLAEGYGCLKLKIGDKECALLAGIRESFSQLEIRVDANGAFSPANAPQLKRLSQFHLHSIEQPIRQHQEMAALCANSPLAIALDEELIGLGAEQRSLDAIRPQYIILKPSLLGGFHYAGQWIELARERGIGFWITSALESNLGLAAIAQWTALYQPTMPQGLGTGQLYTNNLPSNLAVDGGLLGVSE............. 370
14 -79.4003q45_A mol:protein length:368 Mandelate racemase/muconate lactonizing enzym  ali model follow..  20  1..MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGECSPFMT--IHGESMDTAFIVGQYLAKGLIGTSCLDIVSNSLLMDAIYGNSCIKSAFNIALYDLAAQLPLYAFLGGIDEPHKMAADAVQIKKNGFEIIKVKVGGSDVERIRMIREAGDSITLRIDANQGWSVETAIELTLLEPYNIQHCEEPVSRNLALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVALVSKTICYYDFDTPLMFEAVRGGIVYQQRGIIEVPEAGLGAGYQKDY.. 358
15 -79.1002pmq_A mol:protein length:377 Mandelate racemase/muconate lactonizing enzym  ali model follow..  14  1MSLKIAEIQLFQHDLPVVNPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVG-PTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLWGKVPVHELLGGVMEPDEAARQALEKQREGYSRLQVKLGARDIEAIRKVWEAGTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIVSAACTHIASTVLPRLMEGAWPYVAEHYDAENGVRIEGGRIRVPQPGLGLTIDPE... 360
16 -79.0002ozt_A mol:protein length:332 Tlr1174 protein  ali model follow..  15  1..MSL-RWQWRIYEEPLQEPLTTAQGVWRSRSGIYLRLEDEQGQVGYGEIAPLPG--WGSETLNADIALCQQLPGHLTP------EIMATIPEALPAAQFGFATAWQSVGRLPYRVRPWPICALLGSGQAALEQWQQSWQRGQTTFKWKVGEEEQAILKALLAALPGAKLRLDANGSWDRATANRLDRHGNGKIEYVEQPLPPDQALLSLAQTVTTAIALDESVVSAAEVQRWVDRGWPGFFVIKTALFGDP-DSLSLLLRRGLEPQRLVFSSALEGAIARTAIFHLLETWQPCHALGFGVDRWRSAPLLTTLTAYERLWERLDEG........... 326
17 -78.8001fhv_A mol:protein length:323 O-SUCCINYLBENZOATE SYNTHASE  ali model follow..  18  1.GSAMRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCLR-EGEREGWGEISPLPG--FSQETWEEAQSVLLAWVNNWLAGD-----------CELPQMPSVAFGVSCALAELTDTLPQAAAPLCNGDPDDLILKLADMP--GEKVAKVKVGVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGQQVNPDYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEE--GVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAAWLTPDTIPGLDTLDLMQAQQVRRWPGSTLPVVEVDALERL........ 322
18 -78.7001muc_A mol:protein length:373 MUCONATE LACTONIZING ENZYME  ali model follow..  16  3.SALIERIDAIIVDLPTIRPHKLAMHTMQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDALAPALIGLAADNINAAMLKLDKAKGNTFAKSGIESALLDAQGKLPVSELLGGRDTARDIAEARHMLEIRRHRVFKLKIGANDLKHVVTIKREGDSASVRVDVNQYWDESQAIRAQVLGDNGIDLIEQPISRINGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHALTLRQLTWGTELFGPLLTEEIVNEPPQYRDFQLHIPRPGLGLTLDEQ... 365
19 -78.0003iji_A mol:protein length:338 Muconate cycloisomerase  ali model follow..  15  2......KMTFFPYELKLRHVFTVATYSRTTTPDVQVEIE-YEGVTGYGEASMPP---YLGETVESVMNFLKKVNLEQFSDPFQLEDILSYVDSLSPKDTAAKAAVDIALHDLVGKAPWYKIWGLNKETPDVVRAKTKECAGLFNILKVKLGRDDKEMIETIRSV-TDLPIAVDANQGWKDRQYALIHWLKEKGIVMIEQPMPKEQDIAWVTQQSPLPVFADESLQRLGDVAALKG--AFTGINIKLMKCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDF---ADLDGNLLISNDRFKGVEVVNGKITLNDPGIGVMKI..... 338
20 -77.8003ct2_A mol:protein length:382 Muconate cycloisomerase  ali model follow..  16  4HASAIESIETIIVDLPTIRPHKLAMHTMQNQTLVLIRLRCADGIEGLGESTTIGGLAYGNESPDSIKTNIDRFVPLLIGQDASNINAAMLRLEQIRGNTFAKSGIESALLDAQGKLPVSELLGGRDTAKDIAEAQKMLDLRRHRIFKLKIGDRDLAHVIAIKKAGDSASVRVDVNQAWDEAVALRARILGGNGIDLIEQPISRNNGMVRLNASSPAPIMADESIECVEDAFNLAREGAASVFALKIAKNGGPRATLRTAAIAEAAGIGLYGGTMLEGGIGTLASAHALTLNKLSWDTELFGPLLTEDILAEPPVYRDFHLHVSKPGLGLSLDEE... 367
21 -77.3001nu5_A mol:protein length:370 Chloromuconate cycloisomerase  ali model follow..  17  1..MKIEAISTTIVDVPTRRPLQMSFTTVHKQSYVIVQVKA-GGLVGIGEGGSVGGPTWGSESAETIKVIIDNYLPLLVGKDASNLSQARVLMDRVTGNLSAKAAIDIALHDLKARLSIADLIGGTDTARDIDSALEMIETRRHNRFKVKLGAQDLEHIRSIVKAGDRASVRVDVNQGWDEQTASIWPRLEEAGVELVEQPVPRANALRRLTEQNGVAILADESLSSLSSAFELARDHAVDAFSLKLCNMGGIANTLKVAAVAEAAGISSYGGTMLDSTVGTAAALHVATLPSLPYGCELIGPVLGDRLTQQDLEIKDFEVHLPLSGLGVDLDHD... 361
22 -76.7002chr_A mol:protein length:370 CHLOROMUCONATE CYCLOISOMERASE  ali model follow..  17  1..MKIDAIEAVIVDVPTKRPIQMSITTVHQQSYVIVRVYS-EGLVGVGEGGSVGGPVWSAECAETIKIIVERYLPHLLGTDAFNVSGALQTMRAVTGNASAKAAVEMALLDLKARVSIAELLGGPDTKRDLDSAVEMIERRRHNRFKVKLGQDDLIHMEALSNSGSKAYLRVDVNQAWDEQVASVYPELEALGVELIEQPVGRENALRRLSDNNRVAIMADESLSTLASAFDLARDRSVDVFSLKLCNMGGVSATQKIAAVAEASGIASYGGTMLDSTIGTSVALQLSTVPSLPFGCELIGPVLADTLSHEPLEIRDYELQVPTVGHGMTLDED... 361
23 -76.6003i6e_A mol:protein length:385 Muconate cycloisomerase I  ali model follow..  17  6LEQKIIAMDLWHLALPVVSARDHGIGRVGSCEIVVLRLVAEGGAEGFGEASPWAVFTGTPEASYAALD--RYLRPLVIGRRVGDRVAIMDEAARVAHCTEAKAALDSALLDLAGRLPVWALLGGNPDFDADIALMERLRADGVGLIKLKTGAFDIMRLELIARDFPEFRVRVDYNQGLEIDEAVPRLDVAQFQPDFIEQPVRAHHLMARLRGLTDVPLLADESVYGPEDMVRAAHEGICDGVSIKIMKSGGLTRAQTVARIAAAHGLMAYGGDMFEAGLAHLAGTHMIAATPLGCEFYQASYFLNEDILETPFRVEAGQVIVPDPGLGARADPE... 366
24 -76.4003i4k_A mol:protein length:383 Muconate lactonizing enzyme  ali model follow..  14  5.DLTIQKVESRILDVPLIRPHGFATTTSTEQHILLVSVHLENGVIGYGEGVVPGGPWWGGESVETMKALVDGYLPVLIGRAVSELAGIMADLERVARARYAKAAVDVAMHDAWARVPVRDLLGGTPLDVAVAEIEERIEEFGNRSFKLKMGAEDTRRVAELAREGDRVSLRIDINARWDRRTALHYPILAEAGVELFEQPTPADDTLREITRRTNVSVMADESVWTPAEALAVVKAQAADVIALKTTKHGGLLESKKIAAIAEAGGLACHGATSLEGPIGTAASLQFAASTKAISYGTFGPQLLKDTYIVQEFEYKDGQVAIPQPGLGVDVDMD... 367
25 -76.2003rit_A mol:protein length:356 Dipeptide epimerase  ali model follow..  19  1..MKIADIQVRTEHFPLTRPYRIAFRSIEEIDNLIVEIRTADGLLGLGAASPER--HVTGETLEACHAALDHRLGWLMGRDIRTLPRLCRELERLPAAPAARAALDMALHDLVAQLPLVEILGGIKPVEETLAEAREHLALGFRVLKVKLCGDDFERLRRLHETAGRAVVRVDPNQSYDRDGLLRLRLVQELGIEFIEQPFPAGRWLRALPKAIRRRIAADESLLGPADAFAAAPPAACGIFNIKLMKCGGLAPARRIATIAETAGIDLMWGCMDESRISIAAALHAALACPATRYLDLDGSFLARDVAEGGFILEDGRLRVTEPGLGLVYPD.... 356
26 -75.3003jva_A mol:protein length:354 Dipeptide Epimerase  ali model follow..  20  1..MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGI--FITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKSAFAPAAKAAIDIACYDLMGQLPLYQLLGGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGDIARVKAIREAGFDIKLRLDANQAWTPKDAVKAQALADYQIELVEQPVKRRDGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAETTIGITAAAHLAAAQKNITRADLDATFGLETVTGGVSLEAKPLLELGEAGLGIS....... 353
27 -75.2002qdd_A mol:protein length:378 Mandelate racemase/muconate lactonizing enzym  ali model follow..  16  1MSLRITRLTVFHLDLPLAKPYWLSGGRLKRLDSTYLRIDTDEGVTGWGEGCPWGHS-YLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLLPGHSYVKSPIDMACWDILGQLPLWQLLGGTGTPDQMLGLIAEAAAQGYRTHSAKIGAQDIARIEAISAGLDGHRVTFDVNRAWTPAIAVEVLNSVR-ARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPRLASWLGHAHLADDPIPGQGARNRDGLATPPSPGLGVIPDPE... 360
28 -75.0003i6t_A mol:protein length:381 Muconate cycloisomerase  ali model follow..  17  7.SQIIAGFTLWHLSLPVTARRDHGIGSVGAVEVVVLRLQADSGAVGYGEASPWV---VFTGSVEATYAALDRYLPLVLGRAVGDHAAIMEDARAVAHCTEAKAALDTALYDLRARVPVWALLGGDPDFDKDLALMQRLQDDDVRIIKLKTGAFDMMRLERLRADFPAFDIRVDYNQGLHHDVALARRDVATFKPTFIEQPVKAHLLMARIRDAVDVPLLADESIFGPEDMAEHPE--IADGVSIKIMKSGGLTRAQTVARMAAARGLSAYGGDMFEAGLAHLAGAHMIAATPLGCEFYQATYFLCDDILAAPFPVADGHVLVPDPGLGVDVDED... 364
29 -74.6001jpm_A mol:protein length:366 L-Ala-D/L-Glu Epimerase  ali model follow..  18  1..MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTL--VITGDSMDSIESAIHHVLPALLGKSLAGYEAILHDIQHLTGNMSAKAAVEMALYDGWAQLPLYQMLGGVNSPEEMAADAENYLKQGFQTLKIKVGKDDIARIQEIRKRGSAVKLRLDANQGWRPKEAVTAIR-AGLGIELVEQPVHKDDGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLLKTDVFNGGITYSGSTISMPGPGLGIIGAAL... 359
30 -74.6003u9i_A mol:protein length:393 Mandelate racemase/muconate lactonizing enzym  ali model follow..  17  19APTTIRALTVAPLDIPLHEPFGIASGAQEVARNLLVAVELTDGTRGYGEAAPFP--AFNGETQDMAHAAILAARSLVEGADVREWRRIALALPAPGMTGSARCAIETAILDALTRLPLWAFFGGTGSVTAAARAAQAIVARGVTTIKIKIGEHDLARIVAIRDVAPTARLILDGNCGYTAPDALRLDMLGVHGIALFEQPVAKDDGLRRLTATRRVPVAADESVASATDAARLARNAAVDVLNIKLMK-CGIVEALDIAAIARTAGLHLMIGGMVESLLAMTVSACFAAGQGGFRFVDLDTPLLAENPFDGGMTYHGGTIDLTLAGHGVTPRSP... 385
31 -74.4002pce_A mol:protein length:386 putative mandelate racemase/muconate lactoniz  ali model follow..  16  1MSLKITRIDIHRTDLPVRGGVYRLSGEYHSYDATIVSIETDTGLTGWGESTPFGST-YIAAHAGGTRAALELLAPAILGMDPRQHDRIWDRMRDLKGHRDARAALDIACWDIAAQLPLCDMTGGGDTPEAMRAKVARHRAQGFKGHSIKIGALDAERITACLADQPGEWYLADANNGLTVEHALRMSLLPPGLDIVLEAPCASWAETKSLRARCALPLLLDELIQTETDLIAAIRDDLCDGVGLKVSKQGGITPMLRQRAIAAAAGMVMSVQDTVGSQISFAAILHLAQSTPRHLLRC-TRAMTTAELAEIDAPLRDGGASAPSPGLGLRVNRDALG 368
32 -74.3003dg3_A mol:protein length:367 Muconate cycloisomerase  ali model follow..  16  1..MKIVAIGAIPFSIPYTKPLRFASGEVHAAEHVLVRVHTDDGIVGVAEAPPRP--FTYGETQTGIVAVIEQYFPALIGLTLTEREVAHTRMARTVGNPTAKAAIDMAMWDALGQLSVSEMLGGYDPVKMVAEAERIRETYGINTFKVKVGRRDTAVVRALRERGDAIELYVDGNRGWSAAESLRAREMADLDLLFAEELCPADDSRRRLVGQLDMPFIADESVPTPADVTREVLGGSATAISIKTAR-TGFTGSTRVHHLAEGLGLDMVMGNQIDGQIGTACTVSFGTAFERTSRHAGE--DMSDDLLTVPLQISDGQLHRRPPGLGIEIDPD... 358
33 -73.9003eez_A mol:protein length:378 putative Mandelate racemase/muconate lactoniz  ali model follow..  16  1MSLKITRITVYQVDLPLEHPYWLSGGRLKLLDATLVKLETDAGITGWGEGTPWG-HTYVPAHGPGIRAGIETMAPFVLGLDPRRLLDVERAMDILPGHLYAKSPIDMACWDIAGQLPIADLMGGAKSVEETRAVIDRYRQRGYVAHSVKIGGDDIARIRDVEDIEPGEIVLYDVNRGWTRQQALRVMRATEDLHVMFEQPGETLDDIAAIRPLHSAPVSVDECLVTLQDAARVARDGLAEVFGIKLNRVGGLTRAARMRDIALTHGIDMFVMATGGSVLADAEALHLAATIPDHACHAVWACLTVDIAGGRGPRNIDGHLHLPEPGLGVHPDED... 360
34 -73.7003s5s_A mol:protein length:389 Mandelate racemase/muconate lactonizing enzym  ali model follow..  15  4.PTLIRRVSIEALDIPLHEPFGIAGGAQERAANLLVTVELADGTLGFGEAAPLP--AFNGETQDGSRAAAVSLREAVVGSDARAWRAVARALREGGGAGAARCAIETAILDALTKRAGMPLTITTGSPERAEEAARRAAAMGFRALKVKVGGRDPARIEAIHAAAPGASLILDGNGGLTAGEALAVAHARRLGVALLEQPVPRDDGMKEVTRRAGVDVAADESAASAEDVLRVAAERAATVVNIKLMK-GGIAEALDIAAVARAAGLGLMIGGMVESVLAMTASACFAAGLGGFSFVDLDTPLLAENPFDGGFVQRGPALSLEGAGHGVTPQRR... 362
35 -73.4002zad_A mol:protein length:345 Muconate cycloisomerase  ali model follow..  15  2..SRIVNVKLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGEASPSFR--VNGERVEALLAIENAVREMITGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVTVGIDTVENRVKEAKKIFEEGFRVIKIKVGENDIEAVEEIAKVTRGAKYIVDANMGYTQKEAVEFARAKGIDIAVYEQPVRREDGLKFVRFHSPFPVAADESARTKFDVMRLVKEEAVDYVNIKLMK-SGISDALAIVEIAESSGLKLMIGCMGESSLGINQSVHFALGTGAFEFHDLDSHLLKEEVFRGKFIQDGPRMRVKD............. 344
36 -73.4003my9_A mol:protein length:377 Muconate cycloisomerase  ali model follow..  14  5.DSVVERIRIFLVESPIKMARLQGVGNVGSVKRVLLEVTSADGIVGWGEAAPWEVFTGTPEAAFSALD--IYLRPLILGAPIKRVRELMARMDKLVGHGEAKAAVEMALLDILGKLSVADLLGGDPDFDADLERMRAMVPAGHTVFKMKTGAEELRILETMRGEGERIDLRLDFNQALTPFGAMKIRDVDAFRPTFIEQPVPRRHAMAGFAAALDTPILADESCFDAVDLMEVVRRQAADAISVKIMKCGGLMKAQSLMAIADTAGLPGYGGTLWEGGIALAAGTQLIAATPLGCEFYMPHHVLTEDVLEERIANSAGHVIVPDPGLGISISEA... 365
37 -73.0002oqh_A mol:protein length:385 Putative isomerase  ali model follow..  17  1MSLKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETMW-----------APVAAIVRRMAPDLIGTSPFALEAFHRKQHMVYLGYAAIAAVDVACWDAMGKQSVTDLLGGAVRDAMAEHAVRVVEEGGFDAVKLKGTAGDVAILRAVREALPGVNLRVDPNAAWSVPDSVRAIALEELDLEYLEDPCVGIEGMAQVKAKVRIPLCTNMCVVRFEDFAPAMRLNAVDVIHGDVYKWGGIAATKALAAHCETFGLGMNLHSGGELGIATAAHLAVVSSTPVLSRAIDSMYYLHADDIIEPLHLENGRLRVPSPGLGVSVDED... 360
38 -72.0002qde_A mol:protein length:397 Mandelate racemase/muconate lactonizing enzym  ali model follow..  20  1MSLKITKVEVIPISTPMKRAQLMRGATLARIDGVLLKLHSDEGLVGIADAGD-TSSWYRGETQDSITSMICDFFAPLLGEDPTKIEKIVGRMDITRDNNQAKATVDFALHDLVGKVPVYQLLGGAGEPEAVAEEALAVLREGFHFVKLKAGGPDIAMVAEVRRAGDDVDLFIDINGAWTYDQALTTRALEKYNLSKIEQPLPAWDGMARLRGKVATPIYADESAQELHDLLAIINKGAADGLMIKTQKAGGLLKAQRWLTLARLANLPVICGCMVGSGLEASPAAHLLAANDWIAQFPLNSRDIDNDIALNVPRFEGGYLYPNDPGLGIELNED... 372
39 -71.9002pgw_A mol:protein length:384 Muconate cycloisomerase  ali model follow..  17  1MSVKISNVRVRPLVLPLKQPYHWSYGIRESFAVNLIEIEADDGTVGIGECTVAPD-------QTGTAAILYRLAKHLVGHSPHDVAPLIARIFHMRAANQIFSGIDMAMWDLQGKLPVHQLLGGGETAEELARDAAVGHAQGERVFYLKVGKLDLEITAAVRGEIGDARLRLDANEGWSVHDAINMRKLEKYDIEFIEQPTVSWSAMAHVREKVGIPIVADQAAFTLYDVYEICRQRAADMICIGPREIGGIQPMMKAAAVAEAAGLKICIHSSFTTGITTCAEHHIGLAIPNLDDGNQIMWVQEDIVSSPDLTPKNGWLDAFRPGLGFQLAED... 363
40 -71.1003r0k_A mol:protein length:379 Enzyme of enolase superfamily  ali model follow..  17  1MVSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATT--AITGDTLQGMQYIIREIFPVILGSDLSDYKQTLELAKKVMFNSAAKMAIDLAYHDLLAKISVAKLLGACGNVAETIQNIQNGVEANFTAIKVKTGADDIQLLKALDNESKNIKFRFDANQGWNLAQTKQIEEINKYSLEIIEQPVKYYDAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDKGFGFNLAENL.. 361
41 -70.6002ps2_A mol:protein length:371 Putative mandelate racemase/muconate lactoniz  ali model follow..  15  3.DLKIARIDVFQVDLPYSGGYLSAGREYRSFDATIVRITTDTGIEGWGESTPF-GSNYIASHPRGVRAGIATMAPSLIGLDPRRVDRINDAMDDLLGHEDAKTAIDVACWDIFGKLPVCELLGGVGEPEDMRARVAKYRAKGYKGQSVKISGEDAKRITAALANQPDEFFIVDANGKLSVETALRLRLLPHGLDFALEAPCATWRECISLRRKTDIPIIYDELATNEMSIVKILADDAAEGIDLKISKAGGLTRGRRQRDICLAAGYSVSVQETCGSDIAFAAIVHLAQTIPERSLRCECRDMVTVKTADGAFDIQDGFATAPTPGLGIMPRLD... 361
42 -70.6002rdx_A mol:protein length:379 Mandelate racemase/muconate lactonizing enzym  ali model follow..  17  1MSLRITRIRLYKTDLPYVDGGWGAGNAITVARASVVVIDTDAGLQGCGEFTPCGENYMIAHS-EGVDAFARLAAPQLLGQDPRQVARMERLMDHVQGHGYAKAPFDAAFWDILGQQPVWMLLGGKRSEAETRAELARHRAAGYRQFQIKVGADDIDRIRACLPLEPGEKAMADANQGWRVDNAIRLARATRDLDYILEQPCRSYEECQQVRRVADQPMKLDECVTGLHMAQRIVADRGAEICCLKISNLGGLSKARRTRDFLIDNRMPVVAEDSWGGEIASAAVAHFAASTPEEFLINSTDNYNTRSTGLGGPTVHQGRLYASDPGLGVTPDFN... 359
43 -70.2002p88_A mol:protein length:369 Mandelate racemase/muconate lactonizing enzym  ali model follow..  17  1..MKITAIHLYAIRLPLRNPFVISYGSYSDMPSIIVKMETDEGIIGYGEGVADD--HVTGESWESTFHTLKHLTPALIGQNPMNIEKIHDMMDNIYGVPTAKAAIDIACFDIMGKQPVYQLIGGIADPENMAEEAASMIQKGYQSFKMKVGTNDVKRIEAVRERGNDIAIRVDVNQGWKANTLTALRSLGHLNIDWIEQPVIADDAMAHIRSKTDLPLMIDEGLKSSREMRQIIKLEAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESSVASSAGFHVAFSKKIITSVELTGPLKFTKDI-GNLHYDVPFIRLNEPGLGIEINED... 356
44 -69.9004dye_A mol:protein length:398 isomerase  ali model follow..  17  18..MKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETMW-----------APVAAIVRRMAPDLIGTSPFALEAFHRKQHMVYLGYAAIAAVDVACWDAMGKQSVTDLLGGAVRDAMAEHAVRVVEEGGFDAVKLKGTAGDVAILRAVREALPGVNLRVDPNAAWSVPDSVRAIALEELDLEYLEDPCVGIEGMAQVKAKVRIPLCTNMCVVRFEDFAPAMRLNAVDVIHGDVYKWGGIAATKALAAHCETFGLGMNLHSGGELGIATAAHLAVVSSTPVLSRAIDSMYYLHADDIIEPLHLENGRLRVPSPGLGVSVDED... 375
45 -69.0003vc5_A mol:protein length:441 Mandelate racemase/muconate lactonizing prote  ali model follow..  13  16.SMLIREVRVTPVAFRDPPLLNAAGVHQPWALRTIVEVVTDEGITGLGETYG-----------LAHLEQVRAAAARLPGLDVYALHRIYRRVADVVGANRVFAAFEVACLDIQGKRPVADLLGGLDPDGIVAQARLLIGEYGFRSIKLKGGEQEAEAIQALRDAFPGLPLRLDPNAAWTVETSIRVGRALDGVLEYLEDPTPGIDGMARVAAEVPMPLATNMCVVTPEHLPAAVERRPIGVLLIDHHYWGGLVRSAHIATLCATFGIELSMHSNSHLGISLAAMTHLAATPAITHACDTHTPWGQDVVAPGALRFVDGAVPVPDPGLGVELDRD... 398
46 -67.0003caw_A mol:protein length:330 o-succinylbenzoate synthase  ali model follow..  14  1....MIKISYSPYTLKPVQSL-NAATAATAREGVLLKVEWNDGLYGFADLHPWPE--LGDLSLEEQLSDLRM----------------------GRMTTQIEQSIWLARRDALLRKEKKHVFDGGEFQDLKPGFLDGLKNEGYNTVKVKMGRDLQKEADMLTHIASGMRMRLDFNALGSWQTFEKLPLTVRPLIEYVEDPFPF-DFHAWGEARKLAKIALDNQYDKVPWGKIASA--PFDVIVIKPAKTD----VDKAVAQCQKWNLKLAVTSYMDHPVGVVHAVGVAMELKDKYGDMILERLYQMDSFAAELSTQGPYLLKNKTGVGFDKLLE... 320
47 -65.5003vdg_A mol:protein length:445 Probable glucarate dehydratase  ali model follow..  15  21.RIRITGARVTPVAFADPPLLNTVGVHQPYALRAVIQLDTDAGLTGLGETYA-----------TVHLERLQAAAHAIVGRSVFSTNVIRALISDALGGDRVFSPFEVACLDVQGQRPVSDLLGGALDPDGIVAQARRMIDEGFSAIKLKGGEEEMAAVEALRAAFPDHPLRLDPNAAWTPQTSVKVAAGLEGVLEYLEDPTPGLDGMAEVAAQAPMPLATNMCVVAFDQLPAAVAKNSVQVVLSDHHYWGGLQRSRLLAGICDTFGLGLSMHSNSHLGISLAAMVHLAATPNLTYACDTHWPWRHEDVVPGALNFCDGEVQVPAPGLGVEIDED... 402
48 -65.1003ddm_A mol:protein length:392 Putative mandelate racemase/muconate lactoniz  ali model follow..  17  8ASITPARVRAHVFRYPVSTPVKTSFGTMHDRPAVLVEVEDSDGAVGWGEVWCNFPACGAEHRARLVETVLA---PLLTARAFADPAQAFAHLEART-LAQAIAGLDIALCDLAARQPLWAWLGGSGDPENPEDVVARKAAEGYRAFKLKVGARDVRNALHVRELGAATPLMADANQGWDLPRARQMQRLGPAQLDWLEEPLRADREWAELAQAAPMPLAGGENIAGVAAFETALAARSLRVMQPDLAKWGGFSGCLPVARAVVAAGLRY-CPHYLGAGIGLQASAHLLAAVPGLAGVDANDNPLRSLLSPALATLHEGRITLGGPGLGVTPDLA... 375
49 -63.6003uxk_A mol:protein length:383 Mandelate racemase  ali model follow..  15  27.EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFA-----YTPVALKSLKQLLDDMAAMIVN-EPLAPVSLEAMLAKRF-IRMAAAGIDMAAWDALGKTPLVKLLGALDGVKLATERAVTAAELGFRAVKTKIGDQDLAVVRSIRQAGDDFGIMVDYNQSLDVPAAIKRQALQQEGVTWIEEPTLQHDGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLD--------LAGSVIEPTLTFEGGNAVIPDPGVGIIWREK... 376
50 -62.6002oqy_A mol:protein length:391 Muconate cycloisomerase  ali model follow..  15  1..MKITDLELHAVGIPRHTGFV--------NKHVIVKIHTDEGLTGIGEMSDFSHLPLYSVDLHDLKQGLL---SILLGQNPFDLMKINKELTDYEKGSFIRNGIDNALHDLCAKISVSDFLGGSEEVESNLDVVRQKLEQGFDVFRLYVGKNDEEFLSRVKEEGSRVRIKYDFSHLLNWKDAHRAIK--DLGLEMIESPAPRNDGLYQLRLKTDYPI--SEHVWSFKQQQEMIKKDAIDIFNISPVFIGGLTSAKKAAYAAEVASKDVVLGTTQELSVGTAAMAHLGCSLTNINHTSTGPELYVGDVVKNRVTYKDGYLYAPDKGLGIELDES... 362
51 -62.2003toy_A mol:protein length:383 Mandelate racemase/muconate lactonizing enzym  ali model follow..  15  20.TAAITGVTARAVITPMKRPLRNAFGVIDSGPLVLIDVTTDQGVTGHSYLFA-----YTRLALKPLVHLVEDIGRELAGKALVPVDLMKAMDAKFR-VGMAVSGLDMAFWDALGQKPVVELLGGSDARDDERTLRTACDEHGFRAIKSKGGATDEAMIKGLRALGPDIALMLDFNQSLDPAEATRRARLADYDLTWIEEPVPQENGHAAVRERSEIPIQAGENWWFPRGFAEAIAAGASDFIMPDLMKVGGITGWLNVAGQADAASIPMSSHILPEASAHVLPVTPTAHFLEVLD--------FAGAILTEPLRVIDGKVTAKGPGLGLAWNES... 369
52 -61.8003va8_A mol:protein length:445 PROBABLE DEHYDRATASE  ali model follow..  13  20.RSIIKEIVITPVAFHDMPLLNSVGVHEPFALRSIIEIITEDSY-GLGESYG-----------SAHLDRLQKAADKIKGLSVYSTNVIYQRCVESLRNDKVFSPFEVACLDLQGKISVSDLLGGALDPEGVVKQAKKIIDEGFKAIKLKGGADEVAAIKALHKAFPGVPLRLDPNAAWTVETSKWVAKELEGIVEYLEDPAGEIEGMAAVAKEASMPLATNMAVVAFDHLPPSILQDAVQVILSDHHFWGGLRKSQTLASICATWGLRLSMHSNSHLGISLAAMTHLSATPNLDYACDTHWPWKRDVVIEGALKWKDGGVIVPSPGLGVELDRE... 402
53 -61.8003ugv_A mol:protein length:390 Enolase  ali model follow..  11  21.TLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEP-----YVPKAMKYLVPALHDMSDMLAG-QPLAPAEIYDKTRKSL-SMIAASGVDMAVWDALARMPLCTLLGGTEVAAEAVELKAEGQGTGFKGLKLRMGAVDIETAEAVWDAGRDTALMVDFNQGLDMAEAMHRRQIDDLGLEWIEEPVVYDNGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETAHWLEWQS--------WADPILQEPYALSDGDLIVPDPGLGLDWDEDV.. 377
54 -61.2002opj_A mol:protein length:327 O-succinylbenzoate-CoA synthase  ali model follow..  18  1.........MSLTGRAFAIPLRTRFRGITVREGMLVR-----GAAGWGEFSPFA----------------------------------------------EYGPRECARWWAACYEAAELGWPAPVRDTVPVEAARIVASSGCTTAKVKVAANDVARVEAVRDAGPRGRVRIDVNGAWDVDTAVRIRLLDRFELEYVEQPCATVDELAEVRRRVSVPIAADESIRRAEDPLRVRDAEAADVVVLKVQPLGGVRAALRL---AEECGLPVVVSSAVETSVGLAAGVALAALPELPYACGLATLLLHADVCDDPLLPVHGVL----PVRRVDVSEQ... 287
55 -60.4003no1_A mol:protein length:398 Mandelate racemase/muconate lactonizing enzym  ali model follow..  14  21.GLTITRIETIPMVAPLAREFRGSHYHMTHRATIVTRVHTDAGIIGEAYTGD------EHETMFDIDRIIHELAPTLIGQDAMAIERLWDSGYKVT-GLVALAAVNTAIWDAVGKMPLWKLWGGYEPLGSIADEMHNYQELGLAGVKFKVGAEDAARITAAREAGDDFIICIDANQGYKPAVAVDLRRIADLNIRWFEEPVEWHNDMRDVRYQGSVPVCAGQTEFSASGCRDLMETGAIDVCNFDSSWSGGPTAWLRTAAIATSYDVQMGHHEEPQVSTHLLASQPHGTIAEC---FHPDRDPFWWNMITNRPKLNNGTLTLSDPGLGWDLNWD... 380
56 -57.6002oz8_A mol:protein length:389 Mll7089 protein  ali model follow..  12  1MSLSLSHFRITRFQFARDRVIGDSQVRADDVNVAALELVSESGEVGLGFIQTLFNPLPDQQEIESVFE--HEVWPSLKGNRAIALVHRVNRPRGGNQRAPFHEAVQVALWDLAAKLPLHVLLGSRRDDDAFVSLFSHAASIGYSAFKIKVGDRDLRRLELLKTCPAGSKVMIDPNEAWTSKEALTKLVAAGHDLLWVEDPILRHDGLRTLRHAVTWTQINSGEYLDLQGKRLLLEAHAADILNVH----GQVTDVMRIGWLAAELGIPISIG-----NTFLEAGVHMAVALPEVEWLEYSFQNF-DHLVEQPIEIRDGYAYAPDPGHGLVLSEK... 353
57 -57.3002gdq_A mol:protein length:382 yitF  ali model follow..  13  3.LVKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLP--------ALHVGFTKRIIPFLLGKQAGSRLSLVRTIQKW--HQRAASAVSMALTEIAAKCSVCELWGGRQWISRSVSNVEAQLKKGFEQIKVKIGKEDVRHINALQHTGSSITMILDANQSYDAAAAFKWRYFSEWNIGWLEEPLPFDQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRASAHAY-DGSLSRLYALFAQACLPPWSKMKNDHIEPIEWDVLVSLQPSKGMVHIPKKGIGTEINME... 362
58 -56.4002hzg_A mol:protein length:401 Mandelate racemase/muconate lactonizing enzym  ali model follow..  16  1MSLKIDAVDLFYLSMPEVTDAADG-----SQDALLVRVAA-GGHIGWGECEAAPLPSIAAFVCPKSHGVCRPVSDSVLGQRLDGPDDIARIAALVG-APHMLSGIEMALWDLLGRAPAWALLGYSDTPQETLERARAARRDGFAAVKFGWGAADADQIMAAREGGPDGDLMVDVGQIFGEDAAARLPTLDAAGVLWLEEPFDAGAAHAALAGRARVRIAGGEAAHNFHMAQHLMDYGRIGFIQIDCGRIGGLGPAKRVADAAQARGITY-VNHTFTSHLALSASLQPFAGLEADRICEAAPQQLALDITGDHIPDAEGLIRAPEPGLGLQVAAS... 369
59 -56.2002og9_A mol:protein length:393 Mandelate racemase/muconate lactonizing enzym  ali model follow..  14  12.SDRITWVRISSCYLPLATPISDAKKPMTEIAILFAEIETAGGHQGLGFSYS------KRAGGPGQFAHAREIAPALIGEDPSDIAKLWDKLCWAGAS-QAIGAFDVALWDLKAKLSLAKLLGSYTPIDQLMVNASASIERGIGGIKLKVGALDIARVTAVRKHGDAVPLMVDANQQWDRPTAQRMRIFEPFNLVWIEEPLDAYDGHAALALQFDTPIATGEMLTSAAEHGDLIRHRAADYLMPDAPRVGGITPFLKIASLAEHAGLMLAPHFAMELHVHLAAAYPREPWVEHFE--------WLEPLFNERIEIRDGRMLVPTPGLGLTLSGQVKA 373
60 -56.0002pp0_A mol:protein length:398 L-talarate/Galactarate Dehydratase  ali model follow..  17  26..DRIEWVKLSLAFLPLATPVSGRQKPLTEVAIIIAEIRSRDGFEGVGFSYS------KRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLLWAGAS-QAISPIDIALWDMKAKLPLAKLLGAHTPLDQVLKNVVISRENGIGGIKLKVGAEDIRRLTAVREAGDEFPLMVDANQQWDRETAIRMRKMEQFNLIWIEEPLDAYDGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFE--------WLNPLFNEQLELRDGRMWISDHGLGFTLSEQ... 383
61 -55.7002ovl_A mol:protein length:371 Putative racemase  ali model follow..  14  2..SLIERVRTDLYRIPLPTRLTDSHGAMMDFELITVRIEDSDGATGLGYTYT-----VNHGGAAVATMVDKDLRGCLLGADAEQIEKIWQSMWWRL-ATSAISAVDIALWDLKGITPLWKLFGGYDPVADLKTQADRFLAGGFRAIKMKVGKEDVDRVSALREHGDSFPLMVDANMKWTVDGAIRARALAPFDLHWIEEPTIPDDGNARIVRESGHTIAGGENLHTLYDFHNAVRAGSLTLPEPDVSNIGGYTTFRKVAALAEANNMLLTSHGVHDLTVHALASVPHRTYMEAHGF-------GLHAYMAEPMAVTDGCVSAPDPGHGVVLDFE... 355
62 -55.3003mzn_A mol:protein length:450 Glucarate dehydratase  ali model follow..  14  1MSPKITKMNVVPVAGEDGFLLNLSGGHEPWFIRCVLVLEDESGNRGVGEIPS-----------EGILNGLEKCRSLVEGARVNEVKQVLSRARGLLAQGHVITAIESALFDLFGQMPVADLLGQYGTPEAVANLARAAYDRGFKDFKLKGGEEEADCIRALHEAFPEARLALDPNGAWKLDEAVRVLEPIKHLLSYAEDPCGQEGTMAEFKKRTGLPTATNMIATDYKQLQYAVQLNSVDIPLAD-CHFWTMQGAVAVGELCNEWGMTWGSHSNNHFDISLAMMTHVAAACPGEITAIDTHWIWGQRITREPFQIRDGKLTVPKPGLGIELDDD... 402
63 -54.4003t9p_A mol:protein length:388 Mandelate racemase/muconate lactonizing enzym  ali model follow..  13  2....SSGVDLGTENLYFQSMRIARLETFCNEFVGFVRVTTDSGAQGWGQVSTYNAD-------ITCTIFHRQIAPHALGTDALDFADTLDLIYERE-LRRAMTGLDTALWDMRGKKPVATLLGGSTPEDEAERFCRLRDDKGFTAFKWRVGGRTEAVVPTVSRAGDGIEKLVDGNSCYSPARAIEVKLLQDNGIGHFEEPCPEYDQTAAVRAALLLDVAGGEQDCEYSSWQLMLDRGAVDIVQPDVMYMGGMHRTLQVCQMAARAGLPVTPHAA-NLSLVTMCTMHLLRAIPFSIEGPEYYPWQEGLFLGDPYRIEGGQAIVTDPGWGVEISPTW.. 371
64 -54.3001bqg_A mol:protein length:451 D-GLUCARATE DEHYDRATASE  ali model follow..  13  13.APVITDLKVVPVAGHDSMLLNLSGAHGPLFTRNILILTDSSGHVGVGEVP----------GGEGIRKTLEDARHLLINQSIGNYQSLLNKVRNAFADRHAVTAVESALLDLLGQVPVAALLGEGQQRDAVALAEAAYDRYGFKDFKLKGGEDEIAAVTALSERFPDARITLDPNGAWSLKEAVALCRDQHHVLAYAEDPCGAENVMAEFRRSTGLRTATNMIATDWRQMGHAIQLQSVDIPLADP-HFWTMQGSVRVAQMCNEWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIDGQRLTKEPLQIKGGLVEVPKPGLGVELDWD... 410
65 -53.9003p0w_A mol:protein length:470 Mandelate racemase/muconate lactonizing prote  ali model follow..  12  7.TPRVTEMQVIPVAGRDSMLLNLCGAHAPFFTRNLVILKDNAGRTGVGEVPG-----------EGIRQALERVIPLVVGQSIGRTNGVLSSIRRALAGGNVITAVEAALLDLLGQVPVAELLGAGQTPAAIARLAEAATERGFADFKLKGGAEEMEAIAAIKARFPHARVTLDPNGAWSLNEAIALCKGQGHLVAYAEDPCGPEAVMAEFKRATGIPTATNMIATDWRQMGHAVQLHAVDIPLADP-HFWTMQGSVRVAQLCDEWGLTWGSHSNNHFDVSLAMFTHVAAAAPTAIDTHWIWQEAQERLTREPLRIQGGHVAVPEPGLGIEIDMD... 421
66 -53.7003tj4_A mol:protein length:372 Mandelate racemase  ali model follow..  18  1..MKITAVEPFILHLPLSESISDSTHSITHWGVVGAKITTSDGIEGYGFTGTHAHLPSDRLITSCISDCYAPL---LLGEDASDHSRLWTKLARYP-THLALAAVDVALWDIKAKVPLWHYLGGATLEDLLAGSARAVEEDGFTRLKIKVGNIDIARLTAVRERDSAVRIAIDGNGKWDLPTCQRFAAAKDLDIYWFEEPLWYDDSHARLARNTSIPIALGEQLYTVDAFRSFIDAGAVAYVQPDVTRLGGITEYIQVADLALAHRLPVV-----HAGEMSQVHVHLSYWHPASTILEYIP--WIKDHFEEPIHVRDGVYKRPEPGASTTPLAE... 362
67 -53.6003u4f_A mol:protein length:388 Mandelate racemase/muconate lactonizing enzym  ali model follow..  16  2....SSGVDLGTENLYFQSMKLTAIETFTNEFVGFVRVTSEDGARGWGQVSTYHSD-------ITCEVLHRQVAPWMLGQDCSDLDDLLDLVTERE-LRRAMAGVDTAIWDLRGKKPVAELLGGSTPHDEAERMKRLRDAHGFDAFKVRAGGRTEEIVPTMRREGDSAALLIDANSCYAPAQAIELKLLQDHGFSHFEEPCPELEQTKEVSEALDIDVTGGEQDCDLTTWRRMIDMRAVDVVQPDILYLGGICRTLRVARMAEAAALPVTPHCA-NLSLVTLFTMHLLRAIPFSIEGEDYYPWQDGLFVEDPYRIEDGHARVTEPGWGVEICPEWLA 373
68 -53.6003tcs_A mol:protein length:388 Racemase, putative  ali model follow..  16  2....SSGVDLGTENLYFQSMKLKAIETFTNDAVGFVRVTTQDGAQGWGQVSTYHAD-------ITCTVLHRQVAPWMLGQDITDLDDLLDIVTERE-LRRAMAGVDTAIWDLRGKKPVAEVLGGTTPRDEAERLKRLRDTQGFTAFKVRAGGRTEEIIPTMRREGDDVDLLIDANSCYTPDRAIEVHMLQDHGFCHFEEPCPELAQTKQVTDALDIDVTGGEQDCDLPTWQRMIDMRAVDIVQPDILYLGGICRTLRVVEMARAAGLPVTPHCA-NWSLVTLFTMHLLRAIEFSIEGPDYYPWQEGLFVKTPYEIEDGHARVTDPGWGVEISPEWLA 373
69 -53.5001tzz_A mol:protein length:392 Hypothetical protein L1841  ali model follow..  12  3.HMSVRIVDVREITKPISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVV----GYGFNSNGRYGQGGLIREFASRILEADPKKLLNEAGDNLDPDKRSVAVGTIDMAVWDAVAKKPLFRLLAEGKGLSMLRGEMRGYLDRGYNVVKMKIGEEDRMRIEAVLEEGKDAQLAVDANGRFNLETGIAYKMLRDYPLFWYEEVGDPLDLQAALAEFYPGPMATGENLFSHQDARNLLRYGGRDWLQFDCALSYGLCEYQRTLEVLKTHGWSP---SRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVRVENGHITMPDPGIGFEGKSD... 382
70 -52.8002qgy_A mol:protein length:391 Enolase from the environmental genome shotgun  ali model follow..  12  4NNQDISIGKLSRLKIWITDNHLSDDQWSNTKKFIIIKITTEDGIEGWGEAFSINF------REKGIAIIIKELFREISNIPNLSIKSFYNKISLLSDGHSATSAIEIALWDISGKLPLNSLLTKSKDTNDYLRQIEKFYGKKYGGIKIYPMSISIQFVEKVREIGDELPLMLDLAVPEDLDQTKSFKEVSSFNPYWIEEPVDGENLLTEIKNTFNMKVVTGEKQSGLVHFRELISRNAADIFNPDISGMGGLIDIIEISNEASNNGIFISPHCWNSMSVSASAMLHVCSSIPNSEKAEIFPDYFSKKFCELPFDIIDNKAHINKAGLGIVIHEDILS 370
71 -52.6002gl5_A mol:protein length:410 putative dehydratase protein  ali model follow..  14  1MSLKITSIEVFDCELKKRDQ------TMSSYNPVLIRVNTDSGLSGIGEVG-----LAYGAGAKAGVGIIRDLAPLIVGEDPLNIEKIWEFFFRKT---AGMSAIDIALWDIKGKVPVYQLLGGLVTPEEYAEAARAALDDGYDAIKVDPLKMGEARIAAMREAGDDADIIVEIHSLLGTNSAIQFKAIEKYRIFLYEEPIHPLNNMQKVSRSTTIPIATGERSYTRWGYRELLEKQSIAVAQPDLCLCGGITEGKKICDYANIYDTTVQVHVC-GGPVSTVAALHMETAIPNFIIHEHHTN-SIRELCTHDYQPENGYYVAPEPGLGQELNDE... 391
72 -52.6003nxl_A mol:protein length:475 Glucarate dehydratase  ali model follow..  13  11.TPRVTRMQVIPVAGRDSMLLNLCGAHAPYFTRNLVILDDSSGHTGVGEVPG-----------EGIRHALERMTDLVVGQSIGRYQATLNAVRAALSGANVITAIEAALLDLLGQVPVAALLGEGQTPAAIARQAEAAVDRGFADFKLKGGADEMEAIAAIKACFPDARATLDPNGAWSLDEAVALCRGQGHLLAYAEDPCGPEEVMAEFRRATGIPTATNMIATDWRQMDHAVRLQAVDIPLADP-HFWTMQGSVRLAQLCRDWGLTWGSHSNNHFDVSLAMFTHAAAAAPTAIDTHWIWQEGDARLTREPLKIVGGQVAVPEPGLGIELDMA... 425
73 -52.4001kko_A mol:protein length:413 3-METHYLASPARTATE AMMONIA-LYASE  ali model follow..  17  1..MKIKQALFTATGDPVTPGFTSVR---QAGECVSVQLILENGAVAVGDCAAVQYSGAGGRLAEHFIPFLNDIKPLLEGRDVDAFLPNARFFDKLRLHTAVRYGLSQALLDATALRLKTEVVCDEAVDKMILKGVDVLPHALINNVEEKLGFKLSDRILSLRSSRYHPTLHIDVYFDMDPVRCAEIASLEKEAQGLIEGPVDAGNKPDQIRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGCNETEISARTCVHVALAA-------------------------RPMRMLIKPGMGFD....... 392
74 -52.3003mqt_A mol:protein length:394 Mandelate racemase/muconate lactonizing prote  ali model follow..  14  3LGANIVSVEFIPVNVAATNW---------SENTVIVKVTDENGVYGLGEADGPPECMKAFSEIENEHKWLNNIKEAVIGRDPLEFRANYNRMYDTT-GLFAISGIDMALYDLAGKVPAYKLMGGAEIVEAYKPLIAKAKERGAKAVKVCIIKEIVAYLRELREVGWDMDMMVDCLYRWTDWQKARFRQLEDIDLYFIEACLQHDDGHQKLAAAINTRLCGAEMSTTRFEAQEWLEKTGISVVQSDYNRCGGVTELLRIMDICEHHNAQLMPHNW-KTGITAAAARHFGIVCHISEYVEFWNGTLTQQLTLNEPKIIDGAIEVSDPGLGIELNIEF.. 377
75 -52.3003h12_A mol:protein length:397 mandelate racemase  ali model follow..  17  1MSLKITEVKAHALSTPIPERMRVESGLKLNRQMILVEVRTDEGVTGVGSP-------SGPYDLAVLKRAIEDIGPQLIGEDPANINYLWHKVFHGE-GIAAMSGVDIALWDLKGRQPIYQLLGGKFTPDQAADELAGWVEQGFTAAKLKVGRKDAANLRAMRQRGADVEILVDANQSLGRHDALAMRILDEAGCYWFEEPLSIDDGHRILRAQTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTF-NDIITVAANLHLVAASPHPAMFEWDITHLMTRLASYDLKLENGLVQPPQPGLGFEIDWDFVA 371

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.