current user: public




Query: 3h70_A mol:protein length:343 O-succinylbenzoic acid (OSB) synthetase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MSLKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHETIASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVAYGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQDFTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVVVLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGYYFEQDVVAHSGILKEGRLEFRPPLVDITQLQPYEGLast
1 -116.0003h70_A mol:protein length:343 O-succinylbenzoic acid (OSB) synthetase  ali model  100  1MSLKLTALHFYKYSEPFKSQIVTPKVTLTHRDCLFIELIDDKGNAYFGECNAFQTDWYDHETIASVKHVIEQWFEDNRNKSFETYEAALKLVDSLENTPAARATIVMALYQMFHVLPSFSVAYGATASGLSNKQLESLKATKPTRIKLKWTPQIMHQIRVLRELDFHFQLVIDANESLDRQDFTQLQLLAREQVLYIEEPFKDISMLDEVADGTIPPIALDEKATSLLDIINLIELYNVKVVVLKPFRLGGIDKVQTAIDTLKSHGAKVVIGGMYEYGLSRYFTAMLARKGDYPGDVTPAGYYFEQDVVAHSGILKEGRLEFRPPLVDITQLQPYEG 337
2 -93.5001wuf_A mol:protein length:393 hypothetical protein lin2664  ali model follow..  23  9.HMYFQKARLIHAELPLLAPFKTSYGELKSKDFYIIELINEEGIHGYGELEAFPLPDYTEETLSSAILIIKEQLLPLAQRKIRKPEEIQELFSWIQGNEMAKAAVELAVWDAFAKMEKRSLIGASIKVGVSIGLVNQYVDQGYERVKLKIAPNDIQFVEAVRKSFPKLSLMADANSAYNREDFLLLKELDQYDLEMIEQPFKDFVDHAWLQKQLKTRICLDENIRSVKDVEQAHSIGSCRAINLKLARVGGMSSALKIAEYCALNEILVWCGGMLEAGVGRAHNIALAARNEFPGDISASNRFFAEDIVTPAFELNQGRLKVPTEGIGVTLDLKVL. 366
3 -92.4001wue_A mol:protein length:386 mandelate racemase/muconate lactonizing enzym  ali model follow..  23  9.HMNIQSIETYQVRLPLKTPFVTSYGRLEEKAFDLFVITDEQGNQGFGELVAFEQPDYVQETLVTERFIIQQHLIPLLTEAIEQPQEVSTIFEEVKGHWMGKAALETAIWDLYAKRQQKSLFGPKIPVGISLGIVQLAVEKGYQRVKLKIRPGDVEPVALIRQHFPNLPLMVDANSAYTLADLPQLQRLDHYQLAMIEQPFDDFLDHAQLQRELKTRICLDENIRSLKDCQVALALGSCRSINLKIPRVGGIHEALKIAAFCQENDLLVWLGGMFESGVGRALNLQFASQPTFPGDISATERYFYEDIITEPFILEQGTMTVPQLGIGVTLSQTNL. 366
4 -90.0002zc8_A mol:protein length:369 N-acylamino acid racemase  ali model follow..  26  1..MRIEAAELRILELPLKFRFETSFGVQTKRTILLLRLFGE-GLEGLGEGVMERLPLYREETVAGARYLLEEVFLPVLGRDLPNPEALREALAPFRGNPMAKAVLEMAFFDLWAKALGRPLLGGAVEVGVSLGIVERHLEEGYRRIKLKIKPGDYEVLKAVREAFPEATLTADANSAYSLANLAQLKRLDELRLDYIEQPLDDLLDHAKLQRELSTPICLDESLTGAEKARKAIELGAGRVFNVKPARLGGHGESLRVHALAESAGIPLWMGGMLEAGVGRAHNLHLATLPGFPGDVSSASRYWEEDIVEEALEAKDGLMPVPEVGIGVHLKLPFV. 356
5 -89.4003qld_A mol:protein length:388 Mandelate racemase/muconate lactonizing prote  ali model follow..  21  1..MSLQTCVLHRLSLPLKFPMRTAHGHIREKQAILVQLVDADGIEGWSECVALAEPTYTEECTDTAWVMLVHHLVPRFQDQDVDPRTVCEALRDVRGNRMSVAAIEMAVWDWYAAQPLVGLLGGRVEVSATLGMVDAAVEQGFRRVKLKIAPGDRAAIKAVRLRYPDLAIAADANGSYRPEDAPVLRQLDAYDLQFIEQPLDDWFDLAKLQASLRTPVCLDESVRSVRELKLTARLGAARVLNVKPGRLGGFGATLRALDVAGEAGMAAWVGGMYETGVGRVHGLIAAALPLMATDLGPSDRYFEQDVLKEPIAFEPGVIQVPQAGVADWVDRDAV. 365
6 -89.2001r0m_A mol:protein length:375 N-acylamino acid racemase  ali model follow..  25  8..FKIEAAEIVVARLPLKFRFETSFGVQTHKV-VPLLILHGEGVQGVAEGTMEARPMYREETIAGALDLLRGTFLPILGQTFANPEAVSDALGSYRGNRMARAMVEMAAWDLWARTLGVPLLGGQVEVGVSLGIVRRHVEQGYRRIKLKIKPGDVQPVRATREAFPDIRLTVDANSAYTLADAGRLRQLDEYDLTYIEQPLDDLVDHAELARRIRTPLCLDESVASASDARKALALGAGGVINLKVARVGGHAESRRVHDVAQSFGAPVWCGGMLESGIGRAHNIHLSTLSNFPGDTSSASRYWERDLIQEPLEAVDGLMPVPQPGTGVTLDREFL. 363
7 -87.4001sja_A mol:protein length:368 N-acylamino acid racemase  ali model follow..  24  1..MKLSGVELRRVQMPLVAPFRTSFGTQSVRELLLLRAVTPAG-EGWGECVTMAGPLYSSEYNDGAEHVLRHYLIPLLAAEDITAAKVTPLLAKFKGHRMAKGALEMAVLDAELRAHERSFLGSSVPCGVSVGIVGGYLDEGYVRIKLKIEPGDVEPVRAVRERFDDVLLQVDANTAYTLGDAPQLARLDPFGLLLIEQPLEDVLGHAELARRIQTPICLDESIVSARAAADAIKLGAVQIVNIKPGRVGGYLEARRVHDVCAAHGIPVWCGGMIETGLGRAANVALASLPNFPGDTSASDRFYKTDITEP-FVLSGGHLPVPTPGLGVAPIPELL. 356
8 -85.2003mwc_A mol:protein length:400 Mandelate racemase/muconate lactonizing prote  ali model follow..  20  6.SARIDGVSLYEIVIPMKIPFQISSGTCYTRRSLVVEIREG-DLFGYGESAPFEEPFYLGETLETTKVILKNHLLPILGKEPLSIEEFNHLIKNIRGNHFARCGVENAYWDLIAKISLKAMIEKYIESGAALGIVEESLQEGYRRIKIKIKPGDVEPLQETRRAVGDFPLWTDANSSFELDQWETFKAMDAAKCLFHEQPLEALLDLKELGERIETPICLDESLISSRVAEFVAKLGISNIWNIKIQRVGGLLEAIKIYKIATDNGIKLWGGTMPESGLGARFLISLASFRGFPADVAASEKWYGKGNDLVENTMTDGKIYVPDPGASFDMTLSHL. 379
9 -76.5003r0k_A mol:protein length:379 Enzyme of enolase superfamily  ali model follow..  18  1MVSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGV--APATTAITGDTLQGMQYIIREIFAPILGSDLSDYKQTLELAKKVMFNSAAKMAIDLAYHDLLAKISVAKLLGASIVTDVSISCIQNGVEANFTAIKVKTGADDIQLLKALDNEFKNIKFRFDANQGWNLAQTQFIEEINKLNVEIIEQPVYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDKGFGFNLAENLY. 362
10 -76.1003i4k_A mol:protein length:383 Muconate lactonizing enzyme  ali model follow..  15  5.DLTIQKVESRILDVPLIRPHGFATTTSTEQHILLVSVHLENGVIGYGEGVVPGGPWWGGESVETMKALVDGYLAPLIGRAVSELAGIMADLERVARARYAKAAVDVAMHDAWARVPVRDLLGGTVRDKVDVTIEERIEEFGNRSFKLKMGAGDTRRVAELAREVDRVSLRIDINARWDRRTALHLPILAEAGVELFEQPTDDLETLREITRRTNVSVMADESVWTPAEALAVVKAQAADVIALKTTKHGGLLESKKIAAIAEAGGLACHGATSLEGPIGTAASLQFAASTKAYGTELFGPQLLKDTYIVQEFEYKDGQVAIPQPGLGVDVDMDKV. 369
11 -74.6004m0x_A mol:protein length:371 Chloromuconate cycloisomerase  ali model follow..  16  1MTTTITEMSATIVDLPSRRPHKFAATTMHHQSIVLVRVRDSDGGEGIGEAVTPGGPWWGGESVETIKTIIDQYLAPIIGRDPSTIGVASQSMDGVFGNSVAKAAIETALWDDRERIPVSDLLGGLRRKRIPITEAAQKLDVGHRSFKFKMGAEDSRRVLDVLECIPDCAVIVDPNGRWSELEAHRLPILADAGVTVAEQPIWNTDGLARLRDKLSIPIMADESVTTVQQAIALADAGAVSAFAIKIPKSGGLSRAREIAAIAEASGLACFGAATPESSVMGAISAQLYGT-SVGCELF-GPGLLIDEVVTEPLKYDRGELLIPTPGSGVNLDEERL. 365
12 -74.2003fcp_A mol:protein length:381 L-Ala-D/L-Glu epimerase, a muconate lactonizi  ali model follow..  16  3LTATVEQIESWIVDVPTIRPHKLSMTTMGCQSLVIVRLTRSDGICGIGEATTIGGLSYGVESPEAISSAITHYLTPLKGQPADNLNALTARMNGIKGNTFAKSAIETALLDAQGKLPVSALLGGALQTALPVLGEKLLAEGRHRAFKLKIGARDLRHTRAIVEALDRASIRVDVNQAWDAATGAKCRELAAMGVDLIEQPVHDNAALVRLSQQIETAILADEAVATAYDGYQLAQQGFTGAYALKIAKAGGPNSVLALARVAQAAGIGLYGGTMLEGTVGTVASLHAWSTLPLQGTEMFGPLLLKDDIVSVPLTFADGQVALPQPGLGVELDEDKL. 367
13 -73.9003i6e_A mol:protein length:385 Muconate cycloisomerase I  ali model follow..  16  6LEQKIIAMDLWHLALPVVSARDHGIGRVGSCEIVVLRLVAEGGAEGFGEASPWA---VFTGTPEASYAALDRYLRPVIGRRVGDRVAIMDEAARVAHCTEAKAALDSALLDLAGRLPVWALLGGKCRDTIPLSLMERLRADGVGLIKLKTGFRDIMRLELIARDFPEFRVRVDYNQGLEIDEAPRVLDVAQFQPDFIEQPVHHFELMARLRGLTDVPLLADESVYGPEDMVRAAHEGICDGVSIKIMKSGGLTRAQTVARIAAAHGLMAYGGDMFEAGLAHLAGTHMIAA-TLGCEFYQASYFLNEDILETPFRVEAGQVIVPDPGLGARADPEKL. 368
14 -73.9003dg3_A mol:protein length:367 Muconate cycloisomerase  ali model follow..  16  1..MKIVAIGAIPFSIPYTKPLRFASGEVHAAEHVLVRVHTDDGIVGVAEAPP--RPFTYGETQTGIVAVIEQYFAPLIGLTLTEREVAHTRMARTVGNPTAKAAIDMAMWDALGQLSVSEMLGGRMRVSHMLGFERIRETYGINTFKVKVGRRDTAVVRALRERFDAIELYVDGNRGWSAAESLRMREMADLDLLFAEELCDDVLSRRRLVGQLDMPFIADESVPTPADVTREVLGGSATAISIKTARTGFT-GSTRVHHLAEGLGLDMVMGNQIDGQIGTACTVSFGTA-SRHAGELSNFLDMSDDLLTVPLQISDGQLHRRPPGLGIEIDPDKL. 360
15 -73.6001muc_A mol:protein length:373 MUCONATE LACTONIZING ENZYME  ali model follow..  16  3.SALIERIDAIIVDLPTIRPHKLAMHTMQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPLIGLAADNINAAMLKLDKAKGNTFAKSGIESALLDAQGKLPVSELLGGRVRDSLEVAARHMLEIRRHRVFKLKIGANDLKHVVTIKRELDSASVRVDVNQYWDESQAIRCQVLGDNGIDLIEQPIINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLT-TWGTELF-GPLLLTEEIVNEPPQYRDFQLHIPRPGLGLTLDEQRL. 367
16 -73.1002chr_A mol:protein length:370 CHLOROMUCONATE CYCLOISOMERASE  ali model follow..  16  1..MKIDAIEAVIVDVPTKRPIQMSITTVHQQSYVIVRVYSE-GLVGVGEGGSVGGPVWSAECAETIKIIVERYLAPLLGTDAFNVSGALQTMARVTGNASAKAAVEMALLDLKARVSIAELLGGPLRSAIPIAAVEMIERRRHNRFKVKLGFRDLIHMEALSNSLSKAYLRVDVNQAWDEQVASVIPELEALGVELIEQPVENTQALRRLSDNNRVAIMADESLSTLASAFDLARDRSVDVFSLKLCNMGGVSATQKIAAVAEASGIASYGGTMLDSTIGTSVALQLYST-PFGCELI-GPFVLADTLSHEPLEIRDYELQVPTVGHGMTLDEDKV. 363
17 -73.0003ct2_A mol:protein length:382 Muconate cycloisomerase  ali model follow..  16  5.ASAIESIETIIVDLPTIRPHKLAMHTMQNQTLVLIRLRCADGIEGLGESTTIGGLAYGNESPDSIKTNIDRFVAPLIGQDASNINAAMLRLEQIRGNTFAKSGIESALLDAQGKLPVSELLGGRVRDALPVAAQKMLDLRRHRIFKLKIGAGDLAHVIAIKKALDSASVRVDVNQAWDEAVALRCRILGGNGIDLIEQPINNRAGMVRLNASSPAPIMADESIECVEDAFNLAREGAASVFALKIAKNGGPRATLRTAAIAEAAGIGLYGGTMLEGGIGTLASAHAFLT-SWDTELF-GPLLLTEDILAEPPVYRDFHLHVSKPGLGLSLDEERL. 369
18 -72.9001nu5_A mol:protein length:370 Chloromuconate cycloisomerase  ali model follow..  16  1..MKIEAISTTIVDVPTRRPLQMSFTTVHKQSYVIVQVKAG-GLVGIGEGGSVGGPTWGSESAETIKVIIDNYLAPLVGKDASNLSQARVLMDRVTGNLSAKAAIDIALHDLKARLSIADLIGGTMRTSIPIAALEMIETRRHNRFKVKLGARDLEHIRSIVKAVDRASVRVDVNQGWDEQTASIIPRLEEAGVELVEQPVANFGALRRLTEQNGVAILADESLSSLSSAFELARDHAVDAFSLKLCNMGGIANTLKVAAVAEAAGISSYGGTMLDSTVGTAAALHVATLPSLPGCELIGPWVLGDRLTQQDLEIKDFEVHLPLSGLGVDLDHDKV. 363
19 -71.6002pmq_A mol:protein length:377 Mandelate racemase/muconate lactonizing enzym  ali model follow..  15  1MSLKIAEIQLFQHDLPVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVG-PTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLWGKVPVHELLGGALTDSVSSRQALEKQREGYSRLQVKLGARDIEAIRKVWEAVTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIVSAACTHIASTRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQPGLGLTIDPERFG 363
20 -71.5003i6t_A mol:protein length:381 Muconate cycloisomerase  ali model follow..  17  7.SQIIAGFTLWHLSLPVTARRDHGIGSVAGVEVVVLRLQADSGAVGYGEASPWV---VFTGSVEATYAALDRYLRPVLGRAVGDHAAIMEDARAVAHCTEAKAALDTALYDLRARVPVWALLGGRCRDRIPLSLMQRLQDDDVRIIKLKTGFKDMMRLERLRADFPAFDIRVDYNQGLHHDVAARVRDVATFKPTFIEQPVHLRGLMARIRDAVDVPLLADESIFGPEDMAEHPE--IADGVSIKIMKSGGLTRAQTVARMAAARGLSAYGGDMFEAGLAHLAGAHMIAA-TLGCEFYQATYFLCDDILAAPFPVADGHVLVPDPGLGVDVDEDAL. 366
21 -70.9003my9_A mol:protein length:377 Muconate cycloisomerase  ali model follow..  14  5.DSVVERIRIFLVESPIKMARLQGVGNVKGVKRVLLEVTSADGIVGWGEAAPWEVFTGTPEAA---FSALDIYLRPILGAPIKRVRELMARMDKLVGHGEAKAAVEMALLDILGKLSVADLLGGRVRDRIPLSRMRAMVPAGHTVFKMKTGVKELRILETMRGEFERIDLRLDFNQALTPFGAKILRDVDAFRPTFIEQPVRHLDAMAGFAAALDTPILADESCFDAVDLMEVVRRQAADAISVKIMKCGGLMKAQSLMAIADTAGLPGYGGTLWEGGIALAAGTQLIAA-SLGCEFYMPHHVLTEDVLEERIANSAGHVIVPDPGLGISISEASL. 367
22 -70.8002qde_A mol:protein length:397 Mandelate racemase/muconate lactonizing enzym  ali model follow..  20  1MSLKITKVEVIPISTPMKRAQLMRGATLARIDGVLLKLHSDEGLVGIADAGDTS-SWYRGETQDSITSMICDFFAPLLGEDPTKIEKIVGRMDITRDNNQAKATVDFALHDLVGKVPVYQLLGGKTIERIPLGEALAVLREGFHFVKLKAGGPDIAMVAEVRRAVDDVDLFIDINGAWTYDQALTIRALEKYNLSKIEQPLWDLDGMARLRGKVATPIYADESAQELHDLLAIINKGAADGLMIKTQKAGGLLKAQRWLTLARLANLPVICGCMVGSGLEASPAAHLLAIAQFPQENAGNSRDIDNDIALNVPRFEGGYLYPNDPGLGIELNEDLV. 374
23 -70.6004h2h_A mol:protein length:376 Mandelate racemase/muconate lactonizing enzym  ali model follow..  15  3.SLKIAEIQLFQHDLPVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVG-PTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLWGKVPVHELLGGALTDSVSSRQALEKQREGYSRLQVKLGARDIEAIRKVWEAVTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIVSAACTHIASTRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQPGLGLTIDPERFG 364
24 -70.1002p88_A mol:protein length:369 Mandelate racemase/muconate lactonizing enzym  ali model follow..  18  1..MKITAIHLYAIRLPLRNPFVISYGSYSDMPSIIVKMETDEGIIGYGE--GVADDHVTGESWESTFHTLKHTLTPLIGQNPMNIEKIHDMMDNIYGVPTAKAAIDIACFDIMGKQPVYQLIGGRYHEEFPVTEAASMIQKGYQSFKMKVGTNDVKRIEAVRERVNDIAIRVDVNQGWKNNTLTALRSLGHLNIDWIEQPVDDIDAMAHIRSKTDLPLMIDEGLKSSREMRQIIKLEAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESSVASSAGFHVAFSKKISVELT-GPLKFTKDI--GNLHYDVPFIRLNEPGLGIEINEDTL. 358
25 -68.5004e8g_A mol:protein length:391 Mandelate racemase/muconate lactonizing enzym  ali model follow..  16  15QSMKIAEIHVYAHDLPVKDPYTIASSTVWSLQTTLVKIVADSGLAGWGETCPVG-PTYAPSHALGARAALAEMAPGLIGANPLQPLVLRRRMDGLCGHNYAKAAIDIAAYDLMGKVRVADLLGGVAAERVPSRIAAEKVAEGFPRLQIKIGGRDIETVRKVWERITGTRLAVDGNRSLPSRDALRLSRECPEIPFVLEQPCNTLEEIAAIRGRVQHGIYLDESGEDLSTVIRAAGQGLCDGFGMKLTRIGGLQQMAAFRDICEARALPHSCDDAWGGDIIAAACTHIGATVQPRGVWVAQPYIAQPYDEENGIRIAGGHIDLPKPGLGITPDESLFG 378
26 -68.1004mgg_A mol:protein length:369 Muconate lactonizing enzyme  ali model follow..  20  2.HMKITAINVFQVDLPLREGRYSWSNFVEVFDSTVVEIETDEGLKGYAECCPLGSAYL--PSYALGVRSGLQELAPLIGKDPLNIGEINRVMDALRGHPYAKAPIDIACWDLLGKQPLYTLLGGAAQDDVALKKIEGYAAEGYTKFQLKVGGDDINRIHATRSVLKSDLLVADANTGWTRHEAARVVGAVSSLDVYIEQPCLTYEESVSIRRRTALPFVLDEVIDGPNTLVRGIAEDAMDCINLKISKVGGLTKAKLMRDLCIAHGIPMTIEDTWGGDIVTAAIAHLARSTPFTFSATDFNSYGTVDIAEGAPKRVNGRMTTSDPGLGITPIFDVLG 362
27 -66.0002pge_A mol:protein length:377 MenC  ali model follow..  19  1.SLSGMELSYRRSDLIFKRPAGTSRGVLTSKPTWFVRLDID-GHGGQGEVSLIPGLSLPEEQIGRELDLLARRLRAEEPIRLRQGILDSWQVSTDGRFPALRFALEMALLDLLSGGRQEWFDFTRGEKRIPVNQIEAKLAEGYGCLKLKIGAIECALLAGIRESFSQLEIRVDANGAFSPANAQRLKRLSQFHLHSIEQPIHQWSEMAALCANSPLAIALDEELIGLGAEQRSAMLDAIQYIILKPSLLGGFHYAGQWIELARERGIGFWITSALESNLGLAAIAQWTALYQPPQGLGTGQLYT--NNLPSNLAVDGGLLGVSE............. 370
28 -62.2002qdd_A mol:protein length:378 Mandelate racemase/muconate lactonizing enzym  ali model follow..  16  1MSLRITRLTVFHLDLPLAKPYWLSGGRLKRLDSTYLRIDTDEGVTGWGEGCPWG-HSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLLPGHSYVKSPIDMACWDILGQLPLWQLLGGEAATPVPIGLIAEAAAQGYRTHSAKIGGSDIARIEAISAGLDGHRVTFDVNRAWTPAIAVEVLNSVR-ARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTNRLASWLGHAHLADDPIPGQGARNRDGLATPPSPGLGVIPDPEALG 363
29 -61.5003q45_A mol:protein length:368 Mandelate racemase/muconate lactonizing enzym  ali model follow..  20  1..MIITQVELYKSPVKLKEPFKISLGILTHANNVIVRIHTASGHIGYGE--CSPFMTIHGESMDTAFIVGQYLAKGLIGTSCLDIVSNSLLMDAIYGNSCIKSAFNIALYDLAAQLPLYAFLGGKKDKIIMAADAVQIKKNGFEIIKVKVGGSDVERIRMIREAADSITLRIDANQGWSVETAIELTLLEPYNIQHCEEPVNLYTALPKIRQACRIPIMADESCCNSFDAERLIQIQACDSFNLKLSKSAGITNALNIIRLAEQAHMPVQVGGFLESRLGFTAAAHVAVSKTICYYDFDTPLMFEADPVRGGIVYQQGIIEVPEAGLGAGYQKDYL. 359
30 -61.5002rdx_A mol:protein length:379 Mandelate racemase/muconate lactonizing enzym  ali model follow..  17  1MSLRITRIRLYKTDLPYVDGGWGAGNAITVARASVVVIDTDAGLQGCGE--FTPCGENYMIAHSEGVDAFARLAAPLLGQDPRQVARMERLMDHVQGHGYAKAPFDAAFWDILGQQPVWMLLGGKLCDGAPMAELARHRAAGYRQFQIKVGADDIDRIRACLPLEPGEKAMADANQGWRVDNAIRARATRDLDY-ILEQPCRSYEECQQVRRVADQPMKLDECVTGLHMAQRIVADRGAEICCLKISNLGGLSKARRTRDFLIDNRMPVVAEDSWGGEIASAAVAHFAASEEFLINSTDLMNYNTRSTGLGGPTVHQGRLYASDPGLGVTPDFNSLG 362
31 -61.4003rit_A mol:protein length:356 Dipeptide epimerase  ali model follow..  19  1..MKIADIQVRTEHFPLTRPYRIAFRSIEEIDNLIVEIRTADGLLGLGA--ASPERHVTGETLEACHAALDHDRLGLMGRDIRTLPRLCRELAELPAAPAARAALDMALHDLVAQLPLVEILGRPTSVTIGIKPVEEHLALGFRVLKVKLCGDDFERLRRLHETAGRAVVRVDPNQSYDRDGLLRDRLVQELGIEFIEQPFGRTDWLRALPKAIRRRIAADESLLGPADAFALAAPPACGIFNIKLMKCGGLAPARRIATIAETAGIDLMWGCMDESRISIAAALHAAACPATRYLDLDGSFDLARDVAEGGFILEDGRLRVTEPGLGLVYPD.... 356
32 -61.3002ps2_A mol:protein length:371 Putative mandelate racemase/muconate lactoniz  ali model follow..  16  3.DLKIARIDVFQVDLPYSGGYLSAGREYRSFDATIVRITTDTGIEGWGESTPFG-SNYIASHPRGVRAGIATMAPSLIGLDPRRVDRINDAMDDLLGHEDAKTAIDVACWDIFGKLPVCELLGGRTNTRLPLARVAKYRAKGYKGQSVKISGEPVTDAKRITAAQPDEFFIVDANGKLSVETALRLRLLPHGLDFALEAPCATWRECISLRRKTDIPIIYDELATNEMSIVKILADDAAEGIDLKISKAGGLTRGRRQRDICLAAGYSVSVQETCGSDIAFAAIVHLAQTIP--RCILECRDMVTVKTADGAFDIQDGFATAPTPGLGIMPRLDVLG 364
33 -61.2003eez_A mol:protein length:378 putative Mandelate racemase/muconate lactoniz  ali model follow..  17  1MSLKITRITVYQVDLPLEHPYWLSGGRLELLDATLVKLETDAGITGWGEGTPWG-HTYVPAHGPGIRAGIETMAPFVLGLDPRRLLDVERAMDILPGHLYAKSPIDMACWDIAGQLPIADLMGGGSRTPRPIAVIDRYRQRGYVAHSVKIGGDDIARIRDVEDIEPGEIVLYDVNRGWTRQQALRMRATEDLHV-MFEQPGETLDDIAAIRPLHSAPVSVDECLVTLQDAARVARDGLAEVFGIKLNRVGGLTRAARMRDIALTHGIDMFVMATGGSVLADAEALHLAATDHACHAVWACQDMLTVDIAGRGPRNIDGHLHLPEPGLGVHPDEDALG 363
34 -61.1002pce_A mol:protein length:386 putative mandelate racemase/muconate lactoniz  ali model follow..  16  1MSLKITRIDIHRTDLPVRGGVYSGGREYHSYDATIVSIETDTGLTGWGESTPFGST-YIAAHAGGTRAALELLAPAILGMDPRQHDRIWDRMRDLKGHRDARAALDIACWDIAAQLPLCDMTGGRVAGPVPVAKVARHRAQGFKGHSIKIGASDAERITACLADQPGEWYLADANNGLTVEHALRLSLLPPGLDIVLEAPCASWAETKSLRARCALPLLLDELIQTETDLIAAIRDDLCDGVGLKVSKQGGITPMLRQRAIAAAAGMVMSVQDTVGSQISFAAILHLAQSRHLLRCALDTRAMTTAELAEIDAPLRDGGASAPSPGLGLRVNRDALG 368
35 -60.7002zad_A mol:protein length:345 Muconate cycloisomerase  ali model follow..  16  3...RIVNVKLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGE--ASPSFRVNGERVEALLAIENAVREMITGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQTQVCYLLGGETDKTVGIDTVEKIFEEGFRVIKIKVGENDIEAVEEIAKVTRGAKYIVDANMGYTQKEAEFARAVYQIDIAVYEQPVEDIEGLKFVRFHSPFPVAADESARTKFDVMRLVKEEAVDYVNIKLMKSG-ISDALAIVEIAESSGLKLMIGCMGESSLGINQSVHFAGTGAFEFHDLDSHLMLKEEVFRGKFIQDGPRMRVKD............. 344
36 -60.6001jpm_A mol:protein length:366 L-Ala-D/L-Glu Epimerase  ali model follow..  20  1..MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGE--APPTLVITGDSMDSIESAIHHVLKPLLGKSLAGYEAILHDIQHLTGNMSAKAAVEMALYDGWAQLPLYQMLGGETDYTVSVNSPENYLKQGFQTLKIKVGKDDIARIQEIRKRGSAVKLRLDANQGWRPKEAVTIRKMEDLGIELVEQPVDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFASKRNITRFDFDAPLMLKTDVFNGGITYSGSTISMPGPGLGII....... 355
37 -60.6003jva_A mol:protein length:354 Dipeptide Epimerase  ali model follow..  22  1..MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGE--GGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKSAFAPAAKAAIDIACYDLMGQLPLYQLLGGITDITLGIDEPNEKVKLGFDTLKIKVGTGDIARVKAIREAGFDIKLRLDANQAWTPKDAVKIQALADYQIELVEQPVRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAETTIGITAAAHLAAQKNITRADLDATFGLETAPVTGGVSLEAPLLELGEAGLGIS....... 353
38 -60.0003ik4_A mol:protein length:365 Mandelate racemase/muconate lactonizing prote  ali model follow..  16  3LPTTIQAISAEAINLPLTEPFAIASGAQAVAANVLVKVQLADGTLGLGE--AAPFPAVSGETQTGTSAAIERLQSHLLGADVRGWRKLAAMLDHEHEAAAARCGLEMAMLDALTRMPLHVFFGGETDMTITAGDEVAILARGIKSIKVKTAAYDLARLRAIHQAAPTAPLIVDGNCGYDVERALACAACKAIPMVLFEQPLEDWAGMAQVTAQSGFAVAADESARSAHDVLRIAREGTASVINIKLMKAG-VAEGLKMIAIAQAAGLGLMIGGMVESILAMSFSANLAGNGGFDFIDLDTPLFIAEHPFIGGFAQTGGTLQLADAGHGVNLE..... 358
39 -60.0003zvh_A mol:protein length:438 METHYLASPARTATE AMMONIA-LYASE  ali model follow..  14  23IKKGAGHDGFTYTGSTVTEGFTQ---VRQKGESISVLLVLEDGQVAHGDCAAVAYSGAGGRDAKDFIPVIEKEIAPLIGREITNFKPMAEEFDKMRLHTAIRYGITQAILDAVAKVTMAEVIRDEYNPGAEINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFIQTLAEAAKPFHLRIEGPMEDRQKQMEAMRDLRAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTCNETNRSATNIGMACGARQAKPGMGVDEGMVKNEMNRVLALVGRRKKLGPQKLISEEDLNSA. 430
40 -59.5003s5s_A mol:protein length:389 Mandelate racemase/muconate lactonizing enzym  ali model follow..  17  4.PTLIRRVSIEALDIPLHEPFGIAGGAQERAANLLVTVELADGTLGFGE--AAPLPAFNGETQDGSRAAAVSLREAVVGSDARAWRAVARALREAGGAGAARCAIETAILDALTKMPLWAFFGGTTDITITTGSPERAAAMGFRALKVKVGGRDPARIEAIHAAAPGASLILDGNGGLTAGEAALVAHARRLGVALLEQPVDDWDGMKEVTRRAGVDVAADESAASAEDVLRVAAERAATVVNIKLMK-GGIAEALDIAAVARAAGLGLMIGGMVESVLAMTASACFAGLGGFSFVDLDTPLFLAENPFDGGFVQRGPALSLEGAGHGVTPQRRSP. 364
41 -59.1003u9i_A mol:protein length:393 Mandelate racemase/muconate lactonizing enzym  ali model follow..  18  19APTTIRALTVAPLDIPLHEPFGIASGAQEVARNLLVAVELTDGTRGYGEAA--PFPAFNGETQDMAHAAILAARSLVEGADVREWRRIALALPAPGMTGSARCAIETAILDALTRLPLWAFFGGATDVTITTGSVTAAVARGVTTIKIKIGAGDLARIVAIRDVAPTARLILDGNCGYTAPDARLLDMLGVHGIALFEQPVDDEEGLRRLTATRRVPVAADESVASATDAARLARNAAVDVLNIKLMKCG-IVEALDIAAIARTAGLHLMIGGMVESLLAMTVSACFAGQGGFRFVDLDTPLFLAENPFDGGMTYHGGTIDLTLAGHGVTPRSPAL. 387
42 -57.9002pgw_A mol:protein length:384 Muconate cycloisomerase  ali model follow..  16  3.LVKISNVRVRPLVLPLKQPYHWSYGIRESFAVNLIEIEADDGTVGIGECTV-------APDQTGTAAILYRLAKHLVGHSPHDVAPLIARIFHMRAANQIFSGIDMAMWDLQGKLPVHQLLGGAHRKAVGYRDAAVGHAQGERVFYLKVGRGDLEITAAVRGEIGDARLRLDANEGWSVHDAINMRKLEKYDIEFIEQPTWSIPAMAHVREKVGIPIVADQAAFTLYDVYEICRQRAADMICIGPREIGGIQPMMKAAAVAEAAGLKICIHSSFTTGITTCAEHHILAIPNLDDGNQIMWQLVQEDIVSPDLTPKNGWLDAFRPGLGFQLAEDLV. 365
43 -54.6002oqh_A mol:protein length:385 Putative isomerase  ali model follow..  17  1MSLKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETMW-----------APVAAIVRRMAPDLIGTSPFALEAFHRKQHMVYLGYAAIAAVDVACWDAMGKQSVTDLLGGAVRDEVPIHAVRVVEEGGFDAVKLKGTTDDVAILRAVREALPGVNLRVDPNAAWSVPDSVRAIALEELDLEYLEDPCVGIEGMAQVKAKVRIPLCTNMCVVRFEDFAPAMRLNAVDVIHGDVYKWGGIAATKALAAHCETFGLGMNLHSGGELGIATAAHLAVVSSTPVLSRAIDSMYYLHADDIIEPLHLENGRLRVPSPGLGVSVDEDKL. 362
44 -53.2004dye_A mol:protein length:398 isomerase  ali model follow..  17  18..MKITDVDVWVVNLPLVNPFTSSFETKTGETRTVVRVRTDSGVEGWGETMW-----------APVAAIVRRMAPDLIGTSPFALEAFHRKQHMVYLGYAAIAAVDVACWDAMGKQSVTDLLGGAVRDEVPIHAVRVVEEGGFDAVKLKGTTDDVAILRAVREALPGVNLRVDPNAAWSVPDSVRAIALEELDLEYLEDPCVGIEGMAQVKAKVRIPLCTNMCVVRFEDFAPAMRLNAVDVIHGDVYKWGGIAATKALAAHCETFGLGMNLHSGGELGIATAAHLAVVSSTPVLSRAIDSMYYLHADDIIEPLHLENGRLRVPSPGLGVSVDEDKL. 377
45 -52.6003iji_A mol:protein length:338 Muconate cycloisomerase  ali model follow..  15  2......KMTFFPYELKLRHVFTVATYSRTTTPDVQVEI-EYEGVTGYGEASMPP---YLGETVESVMNFLKKVNLEQFSDPFQLEDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPW---STTFTIGIDTPDVVRAKLFNILKVKLGDNDKEMIETIRSV-TDLPIAVDANQGWKDRQLDMIHWLKEKGIVMIEQPMEQLDDIAWVTQQSPLPVFADESLQRLGDVAAL--KGAFTGINIKLMKCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFAD--LDGNLLISNDRF-KGVEVVNGKITLNDPGIGVMKI..... 338
46 -52.4002ozt_A mol:protein length:332 Tlr1174 protein  ali model follow..  15  1..MSL-RWQWRIYEEPLQEPLTTAQGVWRSRSGIYLRLEDEQGQVGYGEIA--PLPGWGSETLNADIALCQQLPGHLTP------EIMATIPEALPAAQFGFATAWQSVGRLPYRVRPWPICALLGSGQAALEQWQQSWQRGQTTFKWKVGEEEQAILKALLAALPGAKLRLDANGSWDRATAAWLDRHGNGKIEYVEQPLDQWQALLSLAQTVTTAIALDESVVSAAEVQRWVDRGWPGFFVIKTALFGDP-DSLSLLLRRGLEPQRLVFSSALEGAIARTAIFHLLTWQPCHALGFGVDRWRSAPLLTTLTAYERLWERLDQEG........... 326
47 -50.1002oqy_A mol:protein length:391 Muconate cycloisomerase  ali model follow..  15  1..MKITDLELHAVGIPRHTGFVN--------KHVIVKIHTDEGLTGIGEMSDFSHLPLYSVDLHDLKQGLLSIL---LGQNPFDLMKINKELTDYEKGSFIRNGIDNALHDLCAKISVSDFLGGRVKEKIKVDVVRQKLEQGFDVFRLYVGKNDEEFLSRVKEEGSRVRIKYDFSHLLNWKDAHRIKRLTKYDLEMIESPANDFDGLYQLRLKTDYPI--SEHVWSFKQQQEMIKKDAIDIFNISPVFIGGLTSAKKAAYAAEVASKDVVLGTTQELSVGTAAMAHLCSLTNINTSDPTGPELYVGDVVKNRVTYKDGYLYAPDKGLGIELDESLL. 364
48 -47.8004gfi_A mol:protein length:329 Mandelate racemase/muconate lactonizing enzym  ali model follow..  16  1.SHMPRYLQATTERFAVAGSFTISRGTRTHADVVTCTI-RDGSFTGIGECVPYP---RYGESIEGVTADIEAMADRV------AAGLTRQELQQVMKPGAARNAVDCALWDLEAKMSGKRA---VTAYTISLADPDTMAAKGRPLLKIKTGADDEARLRAVRAAAPEARIIIDANEGWNDDNIYYLKLAAELKISLIEQPLPAGKDAMLARIEHPVLICADESVHSTEDLAGL--RDRYDAINIKLDKTGGLTEALVMKAEAERLGFTIMVGCMLGTSLGMAPAVLVAQGTAFAD--LDGPLLLAED-RDPGLVYEGSLVYPARPEL.......... 327
49 -47.5001jpd_X mol:protein length:324 L-Ala-D/L-Glu Epimerase  ali model follow..  17  3...HMRTVKVFEEAWPLHTPFVIARGSRSEARVVVVEL-EEEGIKGTGECTPYP---RYGESDASVMAQIMSVVPQL------EKGLTREELQKILPAGAARNALDCALWDLAARRQQQSL---ITAQTVVIGTPDQMANSGAKLLKVKLDHLISERMVAIRTAVPDATLIVDANESWRAEGLARCQLLADLGVAMLEQPLPAQDDAALENFIHPLPICADESCHTRSNLKAL--KGRYEMVNIKLDKTGGLTEALALATEARAQGFSLMLGCMLCTSRAISAALPLVPQVSFAD--LDGPTWLAVD-VEPALQFTTGELHL............... 324
50 -46.6003ddm_A mol:protein length:392 Putative mandelate racemase/muconate lactoniz  ali model follow..  17  9.SITPARVRAHVFRYPVSTPVKTSFGTMHDRPAVLVEVEDSDGAVGWGEVWCNFPACGAEHRARLVETVLAPLL---TARAFADPAQAFAHLEARTA-AQAIAGLDIALCDLAARQPLWAWLGGSGDRENPEDVVARKAAEGYRAFKLKVGFDDVRNALHVRELGAATPLMADANQGWDLPRARQMQRLGPAQLDWLEEPLRPAAEWAELAQAAPMPLAGGENIAGVAAFETALAARSLRVMQPDLAKWGGFSGCLPVARAVVAAGLRY-CPHYLGAGIGLQASAHLAAVPGLA-GVDANDNPLRSLLSPALATLHEGRITLGGPGLGVTPDLAAL. 377
51 -46.1003gc2_A mol:protein length:323 o-succinylbenzoate synthase  ali model follow..  20  1.SNAMRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCL-RDGEREGWGEISPL--PGFSQETWEEAQTALLTWV-----------NDWLQGSEGLPEMPSVAFGASCALAELTGVLPEAADYRAAPLCTGDPDDLVLRLADGEKIAKVKVGVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKAKYVNPDYRARIAFLEEPCKTRDDSRAFARETGIAIAWDESLREADFTFEAEE--GVRAVVIKPTLTGSLDKVREQVAAAHALGLTAVISSSIESSLGLTQLARIAALTPGTLPGLDTLHLMQAQQIRP.......................... 305
52 -45.5003uxk_A mol:protein length:383 Mandelate racemase  ali model follow..  14  27.EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTP------VALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLRMAAAGIDMAAWDALGKVHETPLLLGANARPVQAERAVTAAELGFRAVKTKIGDQDLAVVRSIRQAGDDFGIMVDYNQSLDVPAAIKRQALQQEGVTWIEEPTHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLER----------LAGSVIEPTLTFEGGNAVIPDPGVGIIWREKEI. 378
53 -45.5002gdq_A mol:protein length:382 yitF  ali model follow..  14  4..VKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLP--------ALHVGFTKRIIPFLLGKQAGSRLSLVRTIQKW--HQRAASAVSMALTEIAAKCSVCELWGGRYREEIPVSNVEAQLKKGFEQIKVKIGKEDVRHINALQHTGSSITMILDANQSYDAAAAFKWRYFSEWNIGWLEEPLDQPQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRA-SAHAYDGSLSRLYALFAACLPPWSKMKNDHIEPIEWDVMENPFTPSKGMVHIPKKGIGTEINMEIV. 364
54 -45.2003toy_A mol:protein length:383 Mandelate racemase/muconate lactonizing enzym  ali model follow..  15  20.TAAITGVTARAVITPMKRPLRNAFGVIDSGPLVLIDVTTDQGVTGHSYLFA-----YTRLALKPLVHLVEDIGRELAGKALVPVDLMKAMDAKFRLVGMAVSGLDMAFWDALGQLAGKPVLLGGSARPIPATLRTACDEHGFRAIKSKGGATDEAMIKGLRALGPDIALMLDFNQSLDPAEATRRARLADYDLTWIEEPVENLSGHAAVRERSEIPIQAGENWWFPRGFAEAIAAGASDFIMPDLMKVGGITGWLNVAGQADAASIPMSSHILPEASAHVLPVTPTAHFLEV----------FAGAILTEPLRVIDGKVTAKGPGLGLAWNESAV. 371
55 -45.1002opj_A mol:protein length:327 O-succinylbenzoate-CoA synthase  ali model follow..  19  1.........MSLTGRAFAIPLRTRFRGITVREGMLVR-----GAAGWGEFSPFAE------------------------------------------GPRECARWWAACYEAAELGWPAPVVNATVPAVGPEEAARIVASSGCTTAKVKVAENDVARVEAVRDAGPRGRVRIDVNGAWDVDTAVRIRLLDRFELEYVEQPCATVDELAEVRRRVSVPIAADESIRRAEDPLRVRDAEAADVVVLKVQPLGGVRAALRL---AEECGLPVVVSSAVETSVGLAAGVALAALPELPYACGATLRLLHADVCDDPLLPVHGVL----PVRRVDVSEQRL. 289
56 -44.6003ugv_A mol:protein length:390 Enolase  ali model follow..  11  21.TLTFRKLTARPVLLKLQRPVTARIATIPDWPLILIDIETEEGVPGRAYLEPYVPK-------MKYLVPALHDMSDMLAGQPLAPAEIYDKTRKSLHFMIAASGVDMAVWDALARAANMPLLLGGTPGSVKAELKAEGQGTGFKGLKLRMGAVDIETAEAVWDAGRDTALMVDFNQGLDMAEAMHRRQIDDLGLEWIEEPVDNFDGYAQLRHDLKTPLMIGENFYGPREMHQALQAGACDLVMPDFMRIGGVSGWMRAAGVAGAWGIPMSTHLYPEVGAHVMRVTETAHWLEW----------WADPILQEPYALSDGDLIVPDPGLGLDWDEDVV. 378
57 -44.4001fhv_A mol:protein length:323 O-SUCCINYLBENZOATE SYNTHASE  ali model follow..  19  4....MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVCL-REGEREGWGEISPL--PGFSQETWEEAQSVLLAWV-----------NNWLAGDCELPQMPSVAFGVSCALAELTDTLPQAANYRAAPLCNGDPDDLILKLADGEKVAKVKVGVRDGMVVNLLLEAIPDLHLRLDANRAWTPLKGKYVNPDYRDRIAFLEEPCKTRDDSRAFARETGIAIAWDESLREPD--FAFVAEEGVRAVVIKPTLTGSLEKVREQVQAAHALGLTAVISSSIESSLGLTQLARIAALTPDTIPGLDTLDLMQAQQVRR.......................... 305
58 -44.4003tj4_A mol:protein length:372 Mandelate racemase  ali model follow..  17  1..MKITAVEPFILHLPLSESISDSTHSITHWGVVGAKITTSDGIEGYGFTGTHAHLPSDRLITSCISDCYAPLL---LGEDASDHSRLWTKLARYPSLQLALAAVDVALWDIKAKVPLWHYLGGARTAGVEAGSARAVEEDGFTRLKIKVGNIDIARLTAVRERDSAVRIAIDGNGKWDLPTCQRFAAAKDLDIYWFEEPLDDVTSHARLARNTSIPIALGEQLYTVDAFRSFIDAGAVAYVQPDVTRLGGITEYIQVADLALAHRLPV-AGEMSQVHVHLSYWHPASTILEY----------WIKDHFEEPIHVRDGVYKRPEPGASTTPLAESF. 364
59 -44.2003no1_A mol:protein length:398 Mandelate racemase/muconate lactonizing enzym  ali model follow..  14  21.GLTITRIETIPMVAPLAREFRGSHYHMTHRATIVTRVHTDAGIIGEAYTGD------EHETMFDIDRIIHEELAPLIGQDAMAIERLWDSGYKVTFDLVALAAVNTAIWDAVGKALKMPLLWGGYRNELPMDEMHNYQELGLAGVKFKVGAEDAARITAAREAGDDFIICIDANQGYKPAVAVDLRRIADLNIRWFEEPVNDKRSMRDVRYQGSVPVCAGQTEFSASGCRDLMETGAIDVCNFDSSWSGGPTAWLRTAAIATSYDVQMGHHEEPQVSTHLLASQPHGTIAEC---FHPDRDPFWWNMITNRPKLNNGTLTLSDPGLGWDLNWDYI. 382
60 -44.2003caw_A mol:protein length:330 o-succinylbenzoate synthase  ali model follow..  14  1....MIKISYSPYTLKPVQSL-NAATAATAREGVLLKVEWNDGLYGFADLHPW--PELGDLSL----------------------EEQLSDLRMGRMTTQIEQSIWLARRDALLRKEKKHVFDGGEKIKNNPGFLDGLKNEGYNTVKVKMGRDLQKEADMLTHI-SGMRMRLDFNALGSWQTFVNLPLTVRPLIEYVEDPFP-FDFHAWGEARKLAKIALDNQYDKVPW--GKIASAPFDVIVIKPAKTD----VDKAVAQCQKWNLKLAVTSYMDHPVGVVHAVGVAMEDMILESGCLTHRLYQMDSFAAELSTQGPYLLKNKTGVGFDKLLEAL. 322
61 -44.2004ggb_A mol:protein length:378 Putative uncharacterized protein  ali model follow..  16  1..MKITAVRTHLLEHRLDTPFESASMRFDRRAHVLVEIECDDGTVGWGECLGPA---------RPNAAVVQAYSGWLIGQDPRQTEKIWAVLYNALRDQTALSGIDIALWDIKGKASISMLLGGRWRESVRASEMAERRAEGFHACKIKIGFGDLRVIAAVREAGPDMRLMIDANHGYTVTEAITLDRAAGFGIDWFEEPVEQLDAYARVRAGQPIPVAGGETWHGRYGMWQALSAGAVDILQPDLCGCGGFSEIQKIATLATLHGVRI-VPHVWGTGVQIAAALQFAAMTPDPVRVNPIEPIMEFDVLREPLEAVNGVVTIPDPGLGIEINRDAL. 370
62 -43.4002hzg_A mol:protein length:401 Mandelate racemase/muconate lactonizing enzym  ali model follow..  16  1MSLKIDAVDLFYLSMPEVTDAADG-----SQDALLVRVAAG-GHIGWGECEAAPLPSIAAFVCPKSHGVCRPVSDSVLGQRLDGPDDIARIAALVGYNSHMLSGIEMALWDLLGRAPAWALLGYSASHGKTLERARAARRDGFAAVKFGWGPADADQIMAAREGGPDGDLMVDVGQIFGED-AARLPTLDAAGVLWLEEPFGALAAHAALAGRARVRIAGGEAAHNFHMAQHLMDYGRIGFIQIDCGRIGGLGPAKRVADAAQARGITY-VNHTFTSHLALSASLQPAGLEADR-EYPAAPQQLALDITGDHIRPAEGLIRAPEPGLGLQVAASAL. 371
63 -43.0002og9_A mol:protein length:393 Mandelate racemase/muconate lactonizing enzym  ali model follow..  15  12.SDRITWVRISSCYLPLATPISDAKKPMTEIAILFAEIETAGGHQGLGFS-------YSKRAGGPGQFAHAREIAPLIGEDPSDIAKLWDKLCWAGASTQAIGAFDVALWDLKAKRAGLSLLLGSYRDSVRMVNASASIERGIGGIKLKVGALDIARVTAVRKHGDAVPLMVDANQQWDRPTAQRMRIFEPFNLVWIEEPLYDHEGHAALALQFDTPIATGEMLTSAAEHGDLIRHRAADYLMPDAPRVGGITPFLKIASLAEHAGLMLAPHFAMELHVHLAAAYPREPWVEH--------FEWLEPLFNERIEIRDGRMLVPTPGLGLTLSGQVK. 372
64 -42.9001kko_A mol:protein length:413 3-METHYLASPARTATE AMMONIA-LYASE  ali model follow..  17  1..MKIKQALFIYTGDPVTPGFTS---VRQAGECVSVQLILENGAVAVGDCAAVQGGRDPLFLAEHFIPFLNDHIKPLEGRDVDAFLPNARFFDKRIDGNLLHTALSQALLDATALRLKTEVVCDEWQLPCVPEAIDVLPHALINNVEEKLGFKLSDRILSLRSSRYHPTLHIDVYGTIGLIFIASLEKEAQGLPLYIEGPVDQIRMLTAITKELGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGCNETEISARTCVHVALAAIKPGMGFDEGLNIVFNEMNRTIALLQTK.................. 412
65 -42.9002ovl_A mol:protein length:371 Putative racemase  ali model follow..  13  2..SLIERVRTDLYRIPLPTRLTDSHGAMMDFELITVRIEDSDGATGLGYTYTVNHG-------AAVATMVDKDLRGLLGADAEQIEKIWQSMWWRLHYTSAISAVDIALWDLKGIRARTPLLFGGYDPVVPVTQADRFLAGGFRAIKMKVGKEDVDRVSALREHGDSFPLMVDANMKWTVDGAIRARALAPFDLHWIEEPTDDLVGNARIVRESGHTIAGGENLHTLYDFHNAVRAGSLTLPEPDVSNIGGYTTFRKVAALAEANNMLLTSHGVHDLTVHALASVPHRTYMEA-------HGFGLHAYMAEPMAVTDGCVSAPDPGHGVVLDFERL. 357
66 -42.5002pp0_A mol:protein length:398 L-talarate/Galactarate Dehydratase  ali model follow..  18  25.GDRIEWVKLSLAFLPLATPVSDAKKPLTEVAIIIAEIRSRDGFEGVGFS-------YSKRAGGQGIYAHAKEIADLLGEDPNDIDKIYTKLLWAGASVQAISPIDIALWDMKAKRAGLPLLLGAHRDSVQLKNVVISRENGIGGIKLKVGAEDIRRLTAVREAGDEFPLMVDANQQWDRETAIRMRKMEQFNLIWIEEPLYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEH----------WLNPLFNEQLELRDGRMWISDHGLGFTLSEQAR. 385
67 -41.8003bjs_A mol:protein length:428 Mandelate racemase/muconate lactonizing enzym  ali model follow..  17  38.DMKITKINAIPLRLPEGKTVTMGVGSTIKRDAIIIRVETSEGITGYGEA-------HPGRSPGAITSLIHNTIAPLIGMKATDCVGAWQRVHRMQLSSLAISGIDMALWDIRGKMPLYELLGGSQPKESLAEEAQEYIARGYKALKLRIGDADIERVRHVRKVGDEVDILTDANTAYTMADARRVPVLAEIQAGWLEEPFNDFASYREVAKITLVPIAAGENHYTRFEFGQMLDAGAVQVWQPDLSKCGGITEGIRIAAMASAYRIPI-NAHSSATGLNHAATIHFAATENAGYFEACVSKFFRDMFGTSFEIGADGCVEPPDPGLGIEVDESIF. 405
68 -41.8002qgy_A mol:protein length:391 Enolase from the environmental genome shotgun  ali model follow..  14  11..GKLSRLKIWITDNHLSDD-----QWSNTKKFIIIKITTEDGIEGWGEAFSINFR------EKGIAIIIKELFREISNIPNLSIKSFYNKISLLSDGHSATSAIEIALWDISGKLPLNSLLTKSPKPNVPIRQIEKFYGKKYGGIKIYPMSISIQFVEKVREIGDELPLMLDLAVPEDLDQTKSFKEVSSFNPYWIEEPVENISLLTEIKNTFNMKVVTGEKQSGLVHFRELISRNAADIFNPDISGMGGLIDIIEISNEASNNGIFISPHCWNSMSVSASAMLHVSSIPNSE-EIFPDYINFSKKFCELPFDIIDNKAHINKAGLGIVIHEDIL. 369
69 -41.6004jhm_A mol:protein length:384 Mandelate racemase / muconate lactonizing enz  ali model follow..  11  5.DCRISRVELYALADENAPPIPWADNEPLLYTNNIVRLFTEDGTEGLGATMSYTEN----FFDRCIIESLRTIVPGLIGKNPLMTQELNNWLRCTWGGLPAKSPIDIAAWDIKGKMPLYMLLGGARTVEEYFPYIDDCIEHGFTAIKLHCYCVDVALVEAVEAKYGTIRFMLDTAGFYTPEQAMKMKWMERHNWEWLEAPVYDFKTYQRLVANTDLEISHGNCLLTLQEVTHALSTGMWSDVRQDATVCGGITQLNKCFAIAAGHSKNLEIQSM--YTLTQAANLHVLAHDNCN-EQFYPYEAFELASKTQIRTDKEGYVHAPANGLGVEMDWDAV. 365
70 -41.6004it1_A mol:protein length:446 Putative glucarate dehydratase  ali model follow..  15  16.SMKITRVTVTPIAFRDPPLLNASGIHEPFALRSIIEIESDNGYIGLGESYG-----------APALAIQQQVQSQLIGLDPFNLNQLRRIVQTTVAAHNAYSAFEVAFLDLQARVPLVDLLGGAVRDEVPFQAARMIEAYGFKSIKLKAGEHEVACIKALKKAFPGYPLRIDPNGNWSLETSIRMAELLGDDLQYYEDPTPGLEGMAELHKRTGLPLATNMVVTDFDEFRRSVAQNSVQIVLADHHYWGGLRDTQTLAKMCDTFGLGVSMHSNSHLGISLMAMAHVAAA--VPNLDYACDTHYEEVIKGGKLPIVDGCVKITRPGLGLELDHDQL. 405
71 -41.4003h12_A mol:protein length:397 mandelate racemase  ali model follow..  17  1MSLKITEVKAHALSTPIPERMRVESGAKLNRQMILVEVRTDEGVTGVGSP-------SGPYDLAVLKRAIEDVIGPLIGEDPANINYLWHKVFHGEVSRAAMSGVDIALWDLKGRQPIYQLLGGKFTPDQAADELAGWVEQGFTAAKLKVGRADAANLRAMRQRGADVEILVDANQSLGRHDALAMRILDEAGCYWFEEPLDDIEGHRILRAQTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAW-NPHTFNDIITVAANLHLAASPHPA-EWDITHNDLMTRLASYDLKLENGLVQPPQPGLGFEIDWDFV. 370
72 -41.3003sjn_A mol:protein length:374 Mandelate racemase/muconate lactonizing prote  ali model follow..  15  1MVLKITDIEVLHLRVPAMDA-----DCEWGEDAVIVKVHTDKGIVGVGEADSSPLVVQACIEAPQTNFYCNGLKRLLIGENALEIERLWNKMYWGSNYMHAISAIDIALWDIAGQVPVHTLLGGKYRDKIRCAIVQGLKDQGFSSIKFGGGVTDYAIVKAVREAGPEMEVQIDLASKWHGHSAMMAKRLEEFNLNWIEEPVDSLISYEKLSRQVSQKIAGGESLTTRYEFQEFITKSNADIVQPDITRCGGITEMKKIYDIAQMNGTQL-IPHGFSTGILLHASVHFAACEQGT-EFSQSSSPLFTSLVKNQLQFDNGFVAVSDPGLGIELDEELI. 368
73 -41.3003n4e_A mol:protein length:393 Mandelate racemase/muconate lactonizing enzym  ali model follow..  16  1MSLKIAKVEALSVAMGDGTGWM--------PTSAFVRITAEDGTVGWGEASPMLGG-------IASLGVVARDIAPLEGQEVLDHAVLLDRMMHRLVKTAALAACDIALWDLKGKQPIYKLLGGAWRTRLPCEVARRVEAEQPAAVKIRWDPGDIAKARAVRELGPDAVIGFDANNGYSVGGAIRVRALEDLGYSWFEEPVYHVGAMGEVAQRLDITVSAGEQTYTLQALKDLIL-SGVRMVQPDIVKMGGITGMMQCAALAHAHGVEF-VPHQTQPGVGHFANIHVSTLMHMTKPVELADRWRGRPVFRNPAEPVDGHFALGDPGLGIVVDEDEL. 364
74 -41.1002ppg_A mol:protein length:399 Putative isomerase  ali model follow..  13  3LSDRVKKIESFTLTLPRETPYLGKPRPGEEDRSVLVRIETENGAVGWGETYGLVAP-------RATMEIIDDLLADTIGRDPFDAAAIHDDLYDLMRVRDALAAIDIALWDLAGKLPVCKLLGGQRRDRIAAELAAAWQAKGFSSFKFASPDGVAKEMEILRERGPAVRIACDMHWAHTASEAVALKAMEPHGLWFAEAPVEDIDGLARVAASVSTAIAVGEEWRTVHDMVPRVARRALAIVQPEMGH-KGITQFMRIGAYAHVHHIKVIPHATIGAGIFLAASLQAAALANVD-EFQHSIFEPNRRLLVGDMDCLNGEYVVPTPGLGVEPSKEAQ. 385
75 -40.9003vc5_A mol:protein length:441 Mandelate racemase/muconate lactonizing prote  ali model follow..  13  16.SMLIREVRVTPVAFRDPPLLNAAGVHQPWALRTIVEVVTDEGITGLGETYG-----------LAHLEQVRAAAARLPGLDVYALHRIYRRVADVVGANIVFAAFEVACLDIQGKRPVADLLGGKVRDAVPYQARLLIGEYGFRSIKLKGGEQEAEAIQALRDAFPGLPLRLDPNAAWTVETSIRVGRALDGVLEYLEDPTPGIDGMARVAAEVPMPLATNMCVVTPEHLPAAVERRPIGVLLIDHHYWGGLVRSAHIATLCATFGIELSMHSNSHLGISLAAMTHLAAA--TPAITHACDTHTQDVVAPGALRFVDGAVPVPDPGLGVELDRDAL. 400

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.