current user: public




Query: 3gyz_A mol:protein length:151 Chaperone protein ipgC, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQLast
1 -70.7003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model  100  1GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ 151
2 -65.4003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model   97  2.....STGSSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ 147
3 -57.3002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model   25  2................PLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPLSTRVSSMLEAIK 140
4 -57.3002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model   25  2................PLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPLSTRVSSMLEAIK 140
5 -57.2002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model   25  2...................SDGGTLAMLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPLAARAGAMLEAVT 137
6 -47.8002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model   12  6......NLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS.............. 136
7 -46.4001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model   10  1...................QNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQ............... 117
8 -45.8002vyi_A mol:protein length:131 SGTA PROTEIN  ali model   11  2.........................PLGSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIA.... 123
9 -44.3002wqh_A mol:protein length:125 CTPR3Y3  ali model   14  5...............................PGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAKQNLGNA.... 120
10 -44.2003as8_A mol:protein length:186 Magnetosome protein MamA  ali model   10  54.............KTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVELALVP...... 185
11 -44.1003kd7_A mol:protein length:125 CTPR390  ali model   15  2.............................AMDPNSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNLGNA.... 120
12 -44.1003asg_A mol:protein length:186 MamA  ali model   10  47......HLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVE........... 180
13 -44.1001na0_A mol:protein length:125 designed protein CTPR3  ali model   15  2.............................AMDPNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNA.... 120
14 -44.0003asd_A mol:protein length:200 MamA  ali model   11  54.............KTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVE........... 180
15 -43.9003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model   15  2.........................PRSMAPTPE-SDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKR 126
16 -43.8002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model   12  2...........................GSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMM.. 123
17 -43.3002q7f_A mol:protein length:243 YrrB protein  ali model   90......GAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAIDIQPDHMLALHAKKLL.... 230
18 -43.1003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model   16  1................................SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILK 126
19 -42.2003uq3_A mol:protein length:258 Heat shock protein STI1  ali model   11  110......RTADILTKLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREI..... 249
20 -41.8001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model   15  1................................GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILK 126
21 -40.7003upv_A mol:protein length:126 Heat shock protein STI1  ali model   10  1................................SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYY 119
22 -40.6001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model   11  30......................QILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFR........... 147
23 -40.5003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model   11  137DDLNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGEAS...... 281
24 -40.5003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model   15  50...........LAKYDLAQKDIETYFSKVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANAAQ 189
25 -40.4003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model   11  138.DLNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGEAS...... 281
26 -40.3002kck_A mol:protein length:112 TPR repeat  ali model   13  1..............................MVDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDNKDVWAAKADALRYIEGKEVEAEIAEARAKLE................. 106
27 -40.1001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model   12  29......................GALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWK 173
28 -39.8003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model   13  153.............SDSLFLEVKELFLAAVRLDPTSIDPQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAM.... 288
29 -39.8001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model   12  24......................GALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNCEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWK 168
30 -39.7003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model   14  3.............................HMKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRI 124
31 -39.6002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model   11  10......RLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDTPEIRSALAELYLSM. 164
32 -39.6003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model   10  171.............LTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHC.... 313
33 -39.5003urz_A mol:protein length:208 Uncharacterized protein  ali model   15  9......QKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEK 204
34 -39.1001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model   15  3.........................EPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI. 127
35 -39.1001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model   13  196................LFLEVKELFLAAVRLDPTSIDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSE.. 330
36 -38.7002e2e_A mol:protein length:177 Formate-dependent nitrite reductase complex n  ali model   11  25................NPEAQLQALQDKIRANPQNSEQWALLGEYYLWQNDYSNSLLAYRQALQLRGENAELYAALATVLYYQASTAQTRAMIDKALALDSNEITALMLLASDAFMQANYAQAIELWQKVMDLNSPRINRTQLVESINMAK 162
37 -38.4002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model   16  46................NTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADL.... 178
38 -38.0001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model   11  72......NLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNV.... 212
39 -37.7001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model   14  2.................................EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEA.. 117
40 -37.6002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model   10  23................DYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLGRLNRPAESMAYFDKALATYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELART.... 156
41 -37.4002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model   16  56.............QRGNTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADL.... 191
42 -37.2002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model   14  2......................SGTDPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI. 129
43 -37.1002l6j_A mol:protein length:111 TPR repeat-containing protein associated with  ali model   10  2.................................SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEGYDRS....... 111
44 -36.9002c2l_A mol:protein length:281 CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN  ali model   15  1................................SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRI 119
45 -36.9003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model   15  1.................................ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKAD 118
46 -36.7002hr2_A mol:protein length:159 Hypothetical protein  ali model   14  1...........................GMKPLKEVVGAYLALAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGEAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERM.... 145
47 -36.7003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model   281......FLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPL.... 421
48 -36.5001na3_A mol:protein length:91 designed protein CTPR2  ali model   18  5...............................PGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG................................. 91
49 -36.4002kat_A mol:protein length:115 uncharacterized protein  ali model   14  3...................AITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSDQQVVKELQVFLRRLAREDAL............................ 108
50 -36.3002y4t_A mol:protein length:450 DNAJ HOMOLOG SUBFAMILY C MEMBER 3  ali model   14  8.......................GTENLYFQSMADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSD 135
51 -36.2002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model   12  275......YMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIAPL.... 415
52 -36.1003k9i_A mol:protein length:117 BH0479 protein  ali model   10  2...............................................VLGLEAQAVPYYEKAIASGKDLAECYLGLGSTFRTLGEYRKAEAVLANGVKQFPNHQALRVFYAMVLYNLGRYEQGVELLLKIIAETSDDETIQSYKQAIL... 105
53 -35.2001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model   10  1GPLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQLGGS..................... 152
54 -35.2002xpi_A mol:protein length:597 ANAPHASE-PROMOTING COMPLEX SUBUNIT CUT9  ali model   15  347.........ASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVV.... 484
55 -35.1002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model   12  24...............................GASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISG.. 144
56 -33.4003ma5_A mol:protein length:100 Tetratricopeptide repeat domain protein  ali model   15  3...............................DPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKLYERLDRTDDAIDTYAQGIEVARETQKDLSELQDAKLKAEGLE.............................. 94
57 -33.2002xev_A mol:protein length:129 YBGF  ali model   16  3....................................RTAYNVAFDALKNGKYDDASQLFLSFLELYPNGPNALYWLGESYYATRNFQLAEAQFRDLVSRYPTHAGGLLKLGLSQYGEGKNTEAQQTLQQVATQYPGSDAARVAQERLQSIR 123
58 -32.2003mkr_A mol:protein length:291 Coatomer subunit epsilon  ali model   10  142.............KLDRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINLVVLSQHLGKPPEVTNRYSQLKDAHRSHPFIKEYRAKENDFD 282
59 -32.1003v6t_A mol:protein length:499 dHax3  ali model   10  343......SHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTNDHLALACLGGRPALD 488
60 -32.0002fbn_A mol:protein length:198 70 kDa peptidylprolyl isomerase, putative  ali model   16  30.................................QSAFDIKEEGNEFFKKNEINEAIVKYKEALDFKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVN.. 161
61 -31.4002r5s_A mol:protein length:176 Uncharacterized protein VP0806  ali model   10  2...............................NASPDEQLLKQVSELLQQGEHAQALNVIQTLSDELQSRGDVKLAKADCLLETKQFELALKRLEQELAANPDNFELACELAVQYNQVGRDEEALELLWNILKVNLGAQDGEVKKTFMDILS 155
62 -31.0004abn_A mol:protein length:474 TETRATRICOPEPTIDE REPEAT PROTEIN 5  ali model   15  179.......TDSGDEHSRHVMDSVRQAKLAVQMDVLDGRSWYILGNAYLNPKISQQALSAYAQAEKVDRSNPDLHLNRATLHKYEESYGEALEGFSQAAALDPAWPEPQQREQQLLEFLSRLTSLLESKGKTKPKKLQSMLGSLRPAHL.... 329
63 -31.0003v6p_A mol:protein length:442 dHax3  ali model   10  308............QALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTNDHLLE.......... 436
64 -30.9002avp_A mol:protein length:70 synthetic consensus TPR protein  ali model   17  1.................................GSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS................................................ 70
65 -30.8003rkv_A mol:protein length:162 putative peptidylprolyl isomerase  ali model   9.................................KSVEALRQKGNELFVQKDYKEAIDAYRDALELDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWKLDEAEEDLKLLLRNHPAAASVVARE....... 137
66 -30.7003ffl_A mol:protein length:167 Anaphase-promoting complex subunit 7  ali model   11  9..............................VPRGSHMNVIDHVRDMAAAGLHSNVRLLSSLLLTLPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKPSEIEVKYKLAECYTVLKQDKDAIAILDGIPSRQRTPKINML----LANL. 158
67 -30.7002kc7_A mol:protein length:99 bfr218_protein  ali model   13  2.....................................DQLKTIKELINQGDIENALQALEEFLQTEPVGDEAYYLMGNAYRKLGDWQKALNNYQSAIELNPDSPALQARKMV--------MDILNFYNKDMYNQLE............... 93
68 -30.6002v5f_A mol:protein length:104 PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1  ali model   4..................................TAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS......................... 102
69 -30.5001tjc_A mol:protein length:108 Prolyl 4-hydroxylase alpha-1 subunit  ali model   4..................................TAEDSFELGKVAYTEADYYHTELWMEQALRQLDDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKS......................... 102
70 -30.4003ro3_A mol:protein length:164 G-protein-signaling modulator 2  ali model   11  26............RDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISRE............... 161
71 -29.5001p5q_A mol:protein length:336 FK506-binding protein 4  ali model   13  139.................................EQSTIVKERGTVYFKEGKYKQALLQYKKIVKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQ.. 269
72 -29.1003gw4_A mol:protein length:203 Uncharacterized protein  ali model   10  4.............EAHDYALAERQAQALLAHPATASGARFMLGYVYAFMDRFDEARASFQALQQQHTAEHRALHQVGMVERMAGNWDAARRCFLEERELLAS-SANAYEVATVALHFGDLAGARQEYEKSLVYAQQADDQVAIACAFRGL. 153
73 -28.8001nzn_A mol:protein length:126 Fission protein Fis1p  ali model   12  2....................................SHMEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLRYNDDIRKGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDK.. 119
74 -28.4001iyg_A mol:protein length:133 Hypothetical protein (2010003O14)  ali model   12  2................................SSGSSGMEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLKYNEDIRRGIVLLEELLPKGEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDK.. 123
75 -28.2003kae_A mol:protein length:242 Possible protein of nuclear scaffold  ali model   3........SKLIGKICKSIRYRTAIFLAACLLPCKPEYRMLMSIVLYLNGEYTRALFHLHKL-----NTCTSKYYESLCYKKKKDYKKAIKSLESILEGKGDEEFFESLLGDLCTLSGYREEGIGHYVRSFGKSF................ 145

FFAS is supported by the NIH grant R01-GM087218-01
6 6 2 0 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Plewczynski D, Tkacz A, Wyrwicz LS, Godzik A, Kloczkowski A, Rychlewski L. Support-vector-machine classification of linear functional motifs in proteins. J Mol Model 2006 Aug;12(4):453-61. Epub 2005 Dec 10.