current user: public




Query: 3gyz_A mol:protein length:151 Chaperone protein ipgC, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQLast
1 -75.1003gyz_A mol:protein length:151 Chaperone protein ipgC  ali model  100  1GSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ 151
2 -69.5003ks2_A mol:protein length:151 Chaperone protein ipgC  ali model follow..  97  2.....STGSSISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ 147
3 -64.3003wxx_A mol:protein length:151 AcrH  ali model follow..  25  3............PAIEAFLQDGGTLAMLNDVSTDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSAQLLAAAKPLAARAGIMLEVVK 145
4 -62.4002xcb_A mol:protein length:142 REGULATORY PROTEIN PCRH  ali model follow..  25  2...................SDGGTLAMLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPLAARAGAMLEAVT 137
5 -62.1002vgx_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  25  2................PLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPLSTRVSSMLEAIK 140
6 -61.7002vgy_A mol:protein length:148 CHAPERONE SYCD  ali model follow..  25  2................PLGSGGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPLSTRVSSMLEAIK 140
7 -61.6004nrh_B mol:protein length:178 Chaperone SycD  ali model follow..  18  30.....DLESYLEGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIR 175
8 -46.4002fo7_A mol:protein length:136 SYNTHETIC CONSENSUS TPR PROTEIN  ali model follow..  12  6......NLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRS.............. 136
9 -43.6001na0_A mol:protein length:125 designed protein CTPR3  ali model follow..  15  5...............................PGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNA.... 120
10 -43.5003kd7_A mol:protein length:125 CTPR390  ali model follow..  15  5...............................PGNSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALELDPNNAKAKQNLGNA.... 120
11 -42.7004j8d_A mol:protein length:175 Hsc70-interacting protein  ali model follow..  15  7.DLEIDNEGVIEADTDAPQEMGDENAEITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQPRAQ 156
12 -42.6004xi0_A mol:protein length:202 Magnetosome protein MamA  ali model follow..  11  46......QMGIALANLGDYQRAVTVFDKVLKLRPNHFMASYRKGAVLLKIKQYKLALPVLEAVVAAAPADARAYYLLGLAYDGDEQLEKGIEAMQKAVDLDPEEIKYHQHLGFMNVRKDDHKTAAEHFTKVMELERSQDSDEEELALV.... 186
13 -42.2002wqh_A mol:protein length:125 CTPR3Y3  ali model follow..  14  5...............................PGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELYPNNAEAKQNLGNA.... 120
14 -42.2001hxi_A mol:protein length:121 PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5  ali model follow..  10  1...................QNNTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYE............. 119
15 -42.0003as8_A mol:protein length:186 Magnetosome protein MamA  ali model follow..  10  47......HLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVE........... 180
16 -41.8003asd_A mol:protein length:200 MamA  ali model follow..  11  13......DKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFS.... 153
17 -41.7003vtx_A mol:protein length:184 MamA  ali model follow..  44......KLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAVKYFKKALEKEEKKAKYELALVP..... 183
18 -41.3003asg_A mol:protein length:186 MamA  ali model follow..  11  13......DKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFS.... 153
19 -41.1002q7f_A mol:protein length:243 YrrB protein  ali model follow..  90......GAGNVYVVKEMYKEAKDMFEKALRAGMENGDLFYMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLANEGMLDEALSQFAAVTEQDPGHADAFYNAGVTYAYKENREKALEMLDKAIDIQPDHMLALHAKKLL.... 230
20 -41.0004gcn_A mol:protein length:127 Protein STI-1  ali model follow..  16  2.............................NAMTDAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGRETAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKEL..... 125
21 -39.3003uq3_A mol:protein length:258 Heat shock protein STI1  ali model follow..  12  105.SLTEHRTADILTKLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREI..... 249
22 -38.7003urz_A mol:protein length:208 Uncharacterized protein  ali model follow..  10  59......ELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEEKKKLETDYKKLSSPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKI..... 199
23 -37.9004ga2_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  12  2......PLGSMRRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYVERAAKLFPGSPAVYKLKEQL.... 143
24 -37.8005dse_A mol:protein length:837 Tetratricopeptide repeat protein 7B  ali model follow..  11  695......HAAEVYIGIGKPAEATACTQEAANLFPMSHNVLYMRGQIAELRGSMDEARRWYEEALAISPTHVKSMQRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATECFLTALELEASSPAV........... 828
25 -37.7001xnf_A mol:protein length:275 Lipoprotein nlpI  ali model follow..  12.AVPLQPTLQQEVILARM---EQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQ.. 156
26 -37.7002kck_A mol:protein length:112 TPR repeat  ali model follow..  12  1..............................MVDQNPEEYYLEGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIEDNKDVWAAKADALRYIGKEVEAEIAEARAK.................... 104
27 -37.7003cvq_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  11  138.DLNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGEAS...... 281
28 -37.6003cv0_A mol:protein length:327 Peroxisome targeting signal 1 receptor PEX5  ali model follow..  11  138.DLNVQSEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVGGTTPTGEAS...... 281
29 -37.6001wm5_A mol:protein length:208 Neutrophil cytosol factor 2  ali model follow..  10  2..........................AMGSMSLVEAISLWNEGVLAADKKDWKGALDAFSAVQ---DPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQ... 120
30 -37.4004ga0_A mol:protein length:150 E3 SUMO-protein ligase RanBP2  ali model follow..  12  2......PLGSMRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYLERAAKLFPGSPAIYKLKEQL.... 143
31 -37.3004r7s_A mol:protein length:257 Tetratricopeptide repeat protein  ali model follow..  80......NRASLYTELGETEKALNDYNTLLIENPEHQEALYCRGLLYIQLQNYMWAEQDFDKILEVNEKSVRARLGHAILEKMRGNYDESERIFNYLISEMPRDWILYEGRADLYFMMGKNARAMADIEKVFTESEPTANLYVLRGKI.... 220
32 -37.3002vyi_A mol:protein length:131 SGTA PROTEIN  ali model follow..  11  2.........................PLGSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAEL.. 125
33 -37.2004ga1_A mol:protein length:150 E3 SUMO-PROTEIN LIGASE RANBP2  ali model follow..  12  2......PLGSMRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYMEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPMQKDLVLKIAELLCKNDVTDGAKYWVERAAKLFPGSPAVYKLKEQL.... 143
34 -37.2003fwv_A mol:protein length:128 Hsc70/Hsp90-organizing protein  ali model follow..  16  1................................SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENAYAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPKVLKKCQQAEKILK 126
35 -37.1002pl2_A mol:protein length:217 Hypothetical conserved protein TTC0263  ali model follow..  11  10......RLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSEAYVALGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALEDTPEIRSALAELYLSM. 164
36 -36.9003q47_B mol:protein length:137 STIP1 homology and U box-containing protein 1  ali model follow..  15  5...............................KSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQR............. 111
37 -36.8004gco_A mol:protein length:126 Protein STI-1  ali model follow..  14  1.......................SNARLAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLR.. 126
38 -36.8003upv_A mol:protein length:126 Heat shock protein STI1  ali model follow..  10  1................................SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYY 119
39 -36.6004kbq_A mol:protein length:139 E3 ubiquitin-protein ligase CHIP  ali model follow..  16  7...............................KSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLN........... 115
40 -36.6001na3_A mol:protein length:91 designed protein CTPR2  ali model follow..  18  5...............................PGNSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAKQNLGNAKQKQG................................. 91
41 -36.5002lni_A mol:protein length:133 Stress-induced-phosphoprotein 1  ali model follow..  13  4.............................HMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQ 125
42 -36.1004cgv_A mol:protein length:136 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  16  4.........................EDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQA. 128
43 -36.0003r9a_B mol:protein length:328 Peroxisomal targeting signal 1 receptor  ali model follow..  12  146......RILGSLLSDSLFLEVKELFLAAVRLDPTSIDPQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSE.. 290
44 -36.0003u4t_A mol:protein length:272 TPR repeat-containing protein  ali model follow..  15  50...........LAKYDLAQKDIETYFSKVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANA.. 187
45 -35.9001a17_A mol:protein length:166 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  15  9...............................ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI. 127
46 -35.8001hh8_A mol:protein length:213 NEUTROPHIL CYTOSOL FACTOR 2  ali model follow..  13  1..MSLVEAISLWNEGVLAADKKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAM..... 163
47 -35.8001w3b_A mol:protein length:388 UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUC  ali model follow..  14  38......LLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCV.... 178
48 -35.5001elr_A mol:protein length:131 TPR2A-DOMAIN OF HOP  ali model follow..  15  1................................GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILK 126
49 -35.4002bug_A mol:protein length:140 SERINE/THREONINE PROTEIN PHOSPHATASE 5  ali model follow..  15  11...............................ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKI. 129
50 -35.3003hym_B mol:protein length:330 Cell division cycle protein 16 homolog  ali model follow..  11  171.............LTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFS........... 306
51 -35.2001elw_A mol:protein length:118 TPR1-DOMAIN OF HOP  ali model follow..  14  2.................................EQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEA.. 117
52 -35.1004ui9_F mol:protein length:824 CELL DIVISION CYCLE PROTEIN 27 HOMOLOG  ali model follow..  15  574........GNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASV.... 712
53 -35.0005aio_A mol:protein length:448 TRANSCRIPTION FACTOR TAU 131 KDA SUBUNIT  ali model follow..  25................DLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLNDCCNSWFLAAHLNASDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRSMLYKKTGQLARALDGFQRLYMYNPYDANILRELAIL.... 155
54 -35.0002kat_A mol:protein length:115 uncharacterized protein  ali model follow..  11  1...................................................MQAITERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAALDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLR 100
55 -34.9003sz7_A mol:protein length:164 Hsc70 cochaperone (SGT)  ali model follow..  15  7...............................PTPESDKLKSEGNAAMARKEYSKAIDLYTQALSIAPANPIYLSNRAAAYSASGQHEKAAEDAELATVVDPKYSKAWSRLGLARFDMADYKGAKEAYEKGIEAEGNGGSDAMKRGLETTKR 126
56 -34.8005a31_C mol:protein length:597 CELL DIVISION CYCLE PROTEIN 23 HOMOLOG  ali model follow..  14  338........GNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMA........... 469
57 -34.8004rg6_A mol:protein length:560 Cell division cycle protein 27 homolog  ali model follow..  10  412........GVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDT.... 550
58 -34.7004cgw_A mol:protein length:117 RNA POLYMERASE II-ASSOCIATED PROTEIN 3  ali model follow..  17  14...............................NKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP................ 117
59 -34.6001fch_A mol:protein length:368 PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR  ali model follow..  12  186......RILGSLLSDSLFLEVKELFLAAVRLDPTSIDPQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSE.. 330
60 -34.5002ho1_A mol:protein length:252 Type 4 fimbrial biogenesis protein PilF  ali model follow..  16  46................NTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADL.... 178
61 -34.5003fp2_A mol:protein length:537 TPR repeat-containing protein YHR117W  ali model follow..  281......FLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPL.... 421
62 -34.4003ieg_A mol:protein length:359 DnaJ homolog subfamily C member 3  ali model follow..  15  1.................................ADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSEQEEKEAESQLVKAD 118
63 -34.4004cgu_A mol:protein length:112 TPR REPEAT-CONTAINING PROTEIN ASSOCIATED WITH  ali model follow..  10  3.................................SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK-LQYRLELAQGAVGSVQIPVVEVDELPEGYDRS....... 112
64 -34.1004ui9_J mol:protein length:620 CELL DIVISION CYCLE PROTEIN 16 HOMOLOG  ali model follow..  11  380.............LTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFS........... 515
65 -34.0002vq2_A mol:protein length:225 PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MO  ali model follow..  1AEKANQVSNIKTQLAMEYMRGQASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLGRLNRPAESMAYFDKALATYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELART.... 156
66 -34.0002hr2_A mol:protein length:159 Hypothetical protein  ali model follow..  14  1...........................GMKPLKEVVGAYLALAQRQLVAGEYDEAAANCRRAMEISHTDAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGEAVYSRALALDGLGRGAEAMPEFKKVVEMIEERKGETPGKERM.... 145
67 -33.9004eqf_A mol:protein length:365 PEX5-related protein  ali model follow..  10  179...LTRRMSKSPVDSSVLEGVKELYLEAAHQNGDDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPEDYSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQQQVPHPAIS.. 326
68 -33.9001zu2_A mol:protein length:158 Mitochondrial import receptor subunit TOM20-3  ali model follow..  11  1GPLGSMDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEA---YKQGLGGS................. 152
69 -33.9004uzy_A mol:protein length:651 FLAGELLAR ASSOCIATED PROTEIN  ali model follow..  12  32................KFAEAIQHLQYQLQNVPESRAALSLLGYCYYYTGQYDMASQMYEQLVTLYPSNEDYKLYYAQSLYKGGMYPEASKCRRQLDKCAPEDPDTMVNTGCIMFKEGKFEAARQKFNDAVQALGYQPELLYNIALC.... 190
70 -33.8004i17_A mol:protein length:228 hypothetical protein  ali model follow..  1.............................GAQTTDPNQLKNEGNDALNAKNYAVAFEKYSEYLKLTNNDSVTAYNCGVCADNIKKYKEAADYFDIAIKKNYNLANAYIGKSAAYRDMKNNQEYIATLTEGIKAVPGNA............. 110
71 -33.7002gw1_A mol:protein length:514 Mitochondrial precursor proteins import recep  ali model follow..  12  275......YMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELENKLDGIYVGIAPL.... 415
72 -33.6004hou_A mol:protein length:273 Interferon-induced protein with tetratricopep  ali model follow..  15  150................NYERAKACFEKVLEVDPENPESSAGYAISAYRKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQ................... 273
73 -33.5002fi7_A mol:protein length:265 type 4 fimbrial biogenesis protein PilF  ali model follow..  16  59................NTEQAKVPLRKALEIDPSSADAHAALAVVFQTEMEPKLADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQRLLEASQLYPERSRVFENLGLVSLQMKKPAQAKEYFEKSLRLNRNQPSVALEMADL.... 191
74 -33.0004kvm_A mol:protein length:734 N-terminal acetyltransferase A complex subuni  ali model follow..  12  22.............ETKQYKKGLKAIEPLLERHPEHGESLAIKGILLHSLGNTKEGYDNVRLGLRNDVGSGVCWHIFGLISRADKDYVQAAKCYINAHKLEKNNSSLLRDLALLQSQLRQYKALADTRNALLQDNPGVRANWSALAVA.... 155
75 -33.0002dba_A mol:protein length:148 Smooth muscle cell associated protein-1, isof  ali model follow..  12  26.................................SSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNISGP. 145

FFAS is supported by the NIH grant R01-GM087218-01
8 2 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.