current user: public




Query: 3grc_A mol:protein length:140 Sensor protein, Kinase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MSLAPRPRILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARRPYAAMTVDLNLPDQDGVSLIRALRRDSRTRDLAIVVVSANAREGELEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMAEGKEGLast
1 -75.1003grc_A mol:protein length:140 Sensor protein, Kinase  ali model  100  1MSLAPRPRILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARRPYAAMTVDLNLPDQDGVSLIRALRRDSRTRDLAIVVVSANAREGELEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMAEGKEG 134
2 -67.0001b00_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY  ali model follow..  23  2.....ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEED-RVRGLETGADDYITKPFSPKELVARIKAVMRRISPMA.. 127
3 -67.0002jb9_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY  ali model follow..  21  2.....ARRILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLEWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEED-RVRGLETGADDYITKPFSPKELVARIKAVMRRISPMA.. 127
4 -67.0002jba_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY  ali model follow..  23  2.....ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLRRESMTRDIPVVMLTARGEEED-RVRGLETGADDCITKPFSPKELVARIKAVMRRISPMA.. 127
5 -66.2003t6k_A mol:protein length:136 Response regulator receiver  ali model follow..  22  3....KPHTLLIVDDDDTVAEMLELVLRGAGYEVRRAASGEEALQQIYKNLPDALICDVLLPGIDGYTLCKRVRQHPLTKTLPILMLTAQGDISA-KIAGFEAGANDYLAKPFEPQELVYRVKNILARTTIETP. 130
6 -65.8003cg4_A mol:protein length:142 Response regulator receiver domain protein (C  ali model follow..  20  4..AEHKGDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNSLEQGIAIVMLTAKNAPDA-KMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQTG. 133
7 -65.3004ja2_A mol:protein length:122 Response regulator  ali model follow..  18  2.....SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEED-ESLALSLGARKVMRKPFSPSQFIEEVKHLLNE....... 122
8 -65.2003dge_C mol:protein length:122 Response regulator  ali model follow..  17  2.....SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEED-ESLALSLGARKVMRKPFSPSQFIEEVKHLLNE....... 122
9 -64.2003c3m_A mol:protein length:138 Response regulator receiver protein  ali model follow..  21  2....SLYTILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATPPDLVLLDIMMEPMDGWETLERIKTDPATRDIPVLMLTAKPLTPE-EANEYGSYIEDYILKPTTHHQLYEAIEHVLARRHSIAA. 129
10 -63.2002zay_A mol:protein length:147 Response regulator receiver protein  ali model follow..  17  3LAEGKWWRIMLVDTQLPALAASISALSQEGFDIIQCGNAIEAVPVAVKTHPHLIITEANMPKISGMDLFNSLKKNPQTASIPVIALSGRATAKE-EAQLLDMGFIDFIAKPVNAIRLSARIKRVLKLLYEDLS. 134
11 -63.0001mvo_A mol:protein length:136 PhoP response regulator  ali model follow..  20  3.....NKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLDGIEVCKQLRQQKL--MFPILMLTAKDEEFD-KVLGLELGADDYMTKPFSPREVNARVKAILRRSEIRAP. 127
12 -62.6003cnb_A mol:protein length:143 DNA-binding response regulator, merR family  ali model follow..  18  3LNVKNDFSILIIEDDKEFADMLTQFLENPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFSICHRIKSTPATANIIVIAMTGALTDDN-VSRIVALGAETCFGKPLNFTLLEKTIKQLVEQKKATSEG 137
13 -62.4002qzj_A mol:protein length:136 Two-component response regulator  ali model follow..  20  1..MSLQTKILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRN---VTTCPIVYMTYINEDQS-ILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNSYVN. 127
14 -62.3003nhm_A mol:protein length:133 Response regulator  ali model follow..  23  1..MSLKPKVLIVENSWTMRETLRLLLSG-EFDCTTAADGASGLQQALAHPPDVLISDVNMDGMDGYALCGHFRSEPTLKHIPVIFVSGYAPRTEGP--ADQPVPDAYLVKPVKPPVLIAQLHALLARAEAEG.. 127
15 -61.9003lte_A mol:protein length:132 Response regulator  ali model follow..  25  1MSLKQSKRILVVDDDQAMAAAIERVLKRDHWQVEIAHNGFDAGIKLSTFEPAIMTLDLSMPKLDGLDVIRSLRQNK-VANQPKILVVSGLDKAK-LQQAVTEGADDYLEKPFDNDALLDRIHDLVNE....... 125
16 -61.8002zwm_A mol:protein length:130 Transcriptional regulatory protein yycF  ali model follow..  22  2.....DKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKK---YDMPIIMLTAKDSEID-KVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTLE.. 124
17 -61.3002j48_A mol:protein length:119 TWO-COMPONENT SENSOR KINASE  ali model follow..  22  2......GHILLLEEEDEAATVVCEMLTAAGFKVIWLVDGSTALDQLDLLQPIVILMAWPPPDQSCLLLLQHLREHQADPHPPLVLFLGEPPVDP----LLTAQASAILSKPLDPQLLLTTLQGLCPPN...... 119
18 -61.3003n53_A mol:protein length:140 Response regulator receiver modulated diguany  ali model follow..  14  2....SLKKILIIDQQDFSRIELKNFLDS-EYLVIESKNEKEALEQIDHHHPDLVILDMDIIGENSPNLCLKLKRSKGLKNVPLILLFSSEHKEA-IVNGLHSGADDYLTKPFNRNDLLSRIEIHLRTQNYYSD. 128
19 -61.1001nxo_A mol:protein length:120 DNA-binding response regulator  ali model follow..  22  2......KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRK---TSSVPILMLSAKDSEFD-KVIGLELGADDYVTKPFSNRELQARVKALLRRSQ..... 120
20 -60.6001p6q_A mol:protein length:129 CheY2  ali model follow..  23  1MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRAL-VQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK..... 129
21 -60.5004q7e_A mol:protein length:129 Response regulator of a two component regulat  ali model follow..  23  6.....KPRILLVEDDEGLGETLKERLEQDKYRVEWAKTISEAENLYRPNAFDLVVLDLRLPDGNGFDLAEMIVKKE--KDLPFLFLTAQAGAQE-RLRGFELGAAEFIPKPFHLKEFLIRLERVISLTRPH... 128
22 -60.3005e3j_A mol:protein length:132 Response regulator RstA  ali model follow..  20  5.QEEKLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIRRIISEQPDLVVLDVMLPGADGLTVCREVRPH---YHQPILMLTARTEDMD-QVLGLEMGADDYVAKPVQPRVLLARIRALLRRTDKTVE. 132
23 -60.2004h60_A mol:protein length:120 Chemotaxis protein CheY  ali model follow..  18  1....AMAKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQSQYKFTPILMLTTETSPEK-KQEGKAVGATGWLVKPFNPETLLKTLQRVL......... 120
24 -59.4003cfy_A mol:protein length:137 Putative LuxO repressor protein  ali model follow..  21  1..MSLRPRVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVLDWINQND--IPTSVIIATAHGSV-DLAVNLIQKGAEDFLEKPINADRLKTSVALHLKRAKLEDL. 128
25 -59.4003gt7_A mol:protein length:154 Sensor protein  ali model follow..  20  5...NRAGEILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRPDLIISDVLMPEMDGYALCRWLKGQPDLRTIPVILLTILSDPRD-VVRSLECGADDFITKPCKDVVLASHVKRLLSGVKRTEE. 133
26 -59.3004nic_A mol:protein length:128 DNA-binding transcriptional regulator RstA  ali model follow..  24  1..MAMGNKIVFVEDDPEVGTLIAAYLGKHDMDVVVEPRGDRAEEVIAREKPDLVLLDIMLPGKDGMTLCRDLRGQ---WQGPIVLLTSLDSDMN-HILSLEMGASDYILKTTPPAVLLARLRLHLRQH...... 122
27 -58.9002gkg_A mol:protein length:127 response regulator homolog  ali model follow..  21  5.....SKKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFA--QHRKLKAHADEYVAKPVDADQLVERAGALIGFPE..... 127
28 -58.9004uhj_A mol:protein length:136 TRANSCRIPTIONAL REGULATORY PROTEIN CPXR  ali model follow..  22  2......NKILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLL-DDSIDLLLLDVMMPKKNGIDTLKALRQT---HQTPVIMLTARGSELD-RVLGLELGADDYLPKPFNDRELVARIRAILRRSHWSEQ. 123
29 -58.8001xhe_A mol:protein length:123 Aerobic respiration control protein arcA  ali model follow..  20  2....QTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQA---NVALMFLTGRDNEVD-KILGLEIGADDYITKPFNPRELTIRARNLLSRTMQ.... 123
30 -58.5003crn_A mol:protein length:132 Response regulator receiver domain protein, C  ali model follow..  20  2....SLKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFDIKLPDMEGTELLEKAHKLR--PGMKKIMVTGYASLEN-SVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEKEG.. 126
31 -58.5003lua_A mol:protein length:140 Response regulator receiver protein  ali model follow..  15  1..MSLDGTVLLIDYFEYEREKTKIIFDNIGYDFIEVENLKKFYSIFKDDSITLIIMDIAFPEKEGLEVLSAIRNNSRTANTPVIIATKSDNPGY-RHAALKFKVSDYILKPYPTKRLENSVRSVLKICQRFREG 134
32 -57.8003i42_A mol:protein length:127 Response regulator receiver domain protein (C  ali model follow..  32  2....SLQQALIVEDYQAAAETFKELLEMLGFQADYVMSGTDALHAMSTRGYDAVFIDLNLPDTSGLALVKQLRALPMEKTSKFVAVSGFAKND--LGKEACELFDFYLEKPIDIASLEPILQSIE......... 120
33 -57.5002jvk_A mol:protein length:132 Sporulation initiation phosphotransferase F  ali model follow..  20  3.....NEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIAKRMKVID--ENIRVIIMTAYGEL-DMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSNLE.. 126
34 -57.2004lzl_A mol:protein length:124 Response regulator  ali model follow..  20  2.....GKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLILLNVNLGDMMAQDFAEKLSRTKPA--SVIMILDHWEDLQE-ELEVVQRFAVSYIYKPVLIENLVARISAIFRGRD..... 122
35 -56.9003f7n_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  3....KELKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELLKTIRADGAMSALPVLMVTALAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
36 -56.8001zgz_A mol:protein length:122 TorCAD operon transcriptional regulatory prot  ali model follow..  22  2.....PHHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLTRALRERS---TVGIILVTGRSDRID-RIVGLEMGADDYVTKPLELRELVVRVKNLLWRIDQ.... 122
37 -56.4003a0r_B mol:protein length:116 Response regulator  ali model follow..  20  2......KRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKK--KDAKIILLTAYSHYRSD----SSWAADEYVVKSFNFDELKEKVKKLLS........ 116
38 -56.4003eod_A mol:protein length:130 Protein hnr  ali model follow..  22  7.....GKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNRGD--QTPVLVISATENMAD-IAKALRLGVEDVLLKPVKDNRLREMVFACLYPSM..... 128
39 -56.0003q15_C mol:protein length:126 Sporulation initiation phosphotransferase F  ali model follow..  20  5.....NEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGEL-DMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN.... 126
40 -55.8002qxy_A mol:protein length:142 Response regulator  ali model follow..  18  1..MSLTPTVMVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDV-FEGEESLNLIRRIREE--FPDTKVAVLSAYVDKDL-IINSVKAGAVDYILKPFRLDYLLERVKKIISSTPRVTV. 127
41 -55.5002oqr_A mol:protein length:230 Sensory transduction protein regX3  ali model follow..  24  4.....ATSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVCKQLRARS---SVPVIMVTARDSEID-KVVGLELGADDYVTKPYSARELIARIRAVLRRGGDDDS. 127
42 -55.0002jvi_A mol:protein length:132 Sporulation initiation phosphotransferase F  ali model follow..  20  3.....NEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGEL-DMIQESKELGALTAFAKPFDIDEIRDAVKKYLPLKS..... 123
43 -54.9001m5t_A mol:protein length:124 cell division response regulator DivK  ali model follow..  20  1.....TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAFAMKGDEE-RIREGGCEAYISKPISVVHFLETIKRLLERQPA.... 124
44 -54.7004b09_A mol:protein length:240 TRANSCRIPTIONAL REGULATORY PROTEIN BAER  ali model follow..  27  8...ENTPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTPPDLILLDLMLPGTDGLMLCREIRRFS---DIPIVMVTAKIEEID-RLLGLEIGADDYICKPYSPREVVARVKTILRRCKPQRE. 133
45 -54.6002jvj_A mol:protein length:132 Sporulation initiation phosphotransferase F  ali model follow..  20  3.....NEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGEL-DMAQESKELGALTHFAKPFDIDEIRDAVKKYLPLKS..... 123
46 -54.5001zh2_A mol:protein length:121 KDP operon transcriptional regulatory protein  ali model follow..  28  2......TNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQ----SAVPVIVLSARSEESD-KIAALDAGADDYLSKPFGIGELQARLRVALRRHSQ.... 121
47 -54.0002b4a_A mol:protein length:138 BH3024  ali model follow..  15  5.KIMQPFRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRSQSTCDLLIVSDQLVDLSIFSLLDIVKEQT--KQPSVLILTTGRHELIESSE-----NLSYLQKPFAISELRAAIDYHKPSMGVTMN. 131
48 -54.0002gwr_A mol:protein length:238 DNA-binding response regulator mtrA  ali model follow..  25  5.....RQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADS---GVPIVMLTAKTDTVD-VVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPA. 128
49 -53.8003hdv_A mol:protein length:136 Response regulator  ali model follow..  26  4..VAARPLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLYQKRIGLMITDLRMQPESGLDLIRTIRASER-AALSIIVVSGDTDV-EEAVDVMHLGVVDFLLKPVDLGKLLELVNKELKIGEG.... 130
50 -53.5002pkx_A mol:protein length:121 Transcriptional regulatory protein phoP  ali model follow..  23  2.......RVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHIPDIAIVDLGLPDEDGLSLIRRWRSND--VSLPILVLTARESWQD-KVEVLSAGADDYVTKPFHIEEVMARMQALMRRNSQ.... 121
51 -52.6004qpj_C mol:protein length:152 Cell cycle response regulator CtrA  ali model follow..  25  30.......RVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGIDLGKLYDYDIILLDLNLPDMSGYEVLRTLRLSKV--KTPILILSGMAGIED-KVRGLGFGADDYMTKPFHKDELIARIHAIVRR....... 146
52 -52.2003gwg_A mol:protein length:129 Chemotaxis protein cheY homolog  ali model follow..  17  4....GSMKLLVVDDSSTMRRIIKNTLSRLGYEVLEAEHGVEAWEKLDANDTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGK-AEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTND..... 129
53 -52.1003snk_A mol:protein length:135 Response regulator CheY-like protein  ali model follow..  17  9VTPTKRKQVALFSSDPNFKRDVATRLDALAYDVRVSETDDFLKGPPADTRPGIVILDLGGGDLLGKPGIVEARAL---ATVPLIAVSDELTSEQ-TRVLVRMNASDWLHKPLDGKELLNAVTFHDTGNQ..... 135
54 -51.7003w9s_A mol:protein length:131 OmpR family response regulator in two-compone  ali model follow..  22  2.......KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREK--MTQPVLILTARDTLED-RISGLDTGADDYLVKPFALEELNARIRALLRRHNNQGL. 124
55 -51.6003q9s_A mol:protein length:249 DNA-binding response regulator  ali model follow..  29  26MGRMNEQRILVIEDDHDIANVLRMDLTDAGYVVDHADSAMNGLIKAREDHPDLILLDLGLPDFDGGDVVQRLRKNS---ALPIIVLTARDTVEE-KVRLLGLGADDYLIKPFHPDELLARVKVQLRQRTSE... 152
56 -51.3001ymu_A mol:protein length:130 CHEY  ali model follow..  21  1MRSDKELKFLVVDDFSTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 129
57 -51.2001e6k_A mol:protein length:130 CHEMOTAXIS PROTEIN CHEY  ali model follow..  21  1MRSDKELKFLVVADFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 129
58 -50.9001ys6_A mol:protein length:233 Transcriptional regulatory protein prrA  ali model follow..  25  5...VTSPRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAMD--NDVPVCVLSARSSVDD-RVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSTAT. 131
59 -50.4003rvj_A mol:protein length:132 Chemotaxis protein CheY  ali model follow..  20  3HMADKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAQAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 131
60 -50.3003ffx_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  4.....ELKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELLKTIRADGAMSALPVLMVTAHAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
61 -50.2001p2f_A mol:protein length:220 Response Regulator  ali model follow..  15  2.....MWKIAVVDDDKNILKKVSEKLQQLGR-VKTFLTGEDFLND--EEAFHVVVLDVMLPDYSGYEICRMIKETR--PETWVILLTLLSDDES-VLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKG... 121
62 -50.1003ffw_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  3....KELKFLVVDDQSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
63 -50.1004hnq_A mol:protein length:124 Chemotaxis protein CheY  ali model follow..  20  1..ANKNMKILIVDDFSTMRRIVKNLLRDLGFNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKR-EAIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE........ 124
64 -49.8003fft_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  21  1..ADKELKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTARAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
65 -49.6003rqi_A mol:protein length:184 Response regulator protein  ali model follow..  21  3.GSMSDKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVDLHLGNDSGLSLIAPLCDLQ--PDARILVLTGYASIAT-AVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEA. 131
66 -49.5001djm_A mol:protein length:129 CHEMOTAXIS PROTEIN Y  ali model follow..  21  3...DKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 128
67 -49.5001ab5_A mol:protein length:125 CHEY  ali model follow..  21  1.....ELKFLVVDDNSTMRRITRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 124
68 -49.5001ab6_A mol:protein length:125 CHEMOTAXIS PROTEIN CHEY  ali model follow..  20  1.....ELKFLVVDDNSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMTTAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 124
69 -49.4002fka_A mol:protein length:129 Chemotaxis protein cheY  ali model follow..  21  3...DKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 128
70 -49.4001jbe_A mol:protein length:128 Chemotaxis protein CHEY  ali model follow..  21  4.....ELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRANXAMSALPVLMVTAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
71 -49.4003to5_A mol:protein length:134 CheY homolog  ali model follow..  21  9..LNKNMKILIVDDFSTMRRIVKNLLRDLGFNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKR-EQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFER....... 133
72 -49.3002id7_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  4.....ELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISCWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
73 -49.3003q7r_A mol:protein length:121 Transcriptional regulatory protein  ali model follow..  13  1MRTAGPKHVLLVSEHWDLFFQTKELLNPEEYRCTIGQQYKQELS------ADLVVCEYSLLPREIRSPKS-------LEGSFVLVLLDFFDEET-SVDLLDRGF-WYLIRPITPRILKSAISLFLSQHS..... 114
74 -49.3006chy_A mol:protein length:128 CHEY  ali model follow..  22  4.....ELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKK-ENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLG..... 127
75 -49.2001e6m_A mol:protein length:128 CHEMOTAXIS PROTEIN CHEY  ali model follow..  20  4.....ELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISAWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKK-ENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.