current user: public




Query: 3grc_A mol:protein length:140 Sensor protein, Kinase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MSLAPRPRILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARRPYAAMTVDLNLPDQDGVSLIRALRRDSRTRDLAIVVVSANAREGELEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMAEGKEGLast
1 -71.7003grc_A mol:protein length:140 Sensor protein, Kinase  ali model  100  1MSLAPRPRILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARRPYAAMTVDLNLPDQDGVSLIRALRRDSRTRDLAIVVVSANAREGELEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMAEGKEG 134
2 -65.3003t6k_A mol:protein length:136 Response regulator receiver  ali model follow..  22  2...MKPHTLLIVDDDDTVAEMLELVLRGAGYEVRRAASGEEALQQIYKNLPDALICDVLLPGIDGYTLCKRVRQHPLTKTLPILMLTAQGDISA-KIAGFEAGANDYLAKPFEPQELVYRVKNILARTTIETPT 131
3 -65.3002jb9_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY  ali model follow..  21  2.....ARRILVVEAEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLEWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEED-RVRGLETGADDYITKPFSPKELVARIKAVMRRISPMA.. 127
4 -65.3001b00_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY  ali model follow..  23  2.....ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEED-RVRGLETGADDYITKPFSPKELVARIKAVMRRISPMA.. 127
5 -65.2002jba_A mol:protein length:127 PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY  ali model follow..  23  2.....ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLRRESMTRDIPVVMLTARGEEED-RVRGLETGADDCITKPFSPKELVARIKAVMRRISPMA.. 127
6 -64.5003cg4_A mol:protein length:142 Response regulator receiver domain protein (C  ali model follow..  20  5...EHKGDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNSLEQGIAIVMLTAKNAPDA-KMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQTG. 133
7 -64.0003c3m_A mol:protein length:138 Response regulator receiver protein  ali model follow..  21  1...MSLYTILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATPPDLVLLDIMMEPMDGWETLERIKTDPATRDIPVLMLTAKPLTPE-EANEYGSYIEDYILKPTTHHQLYEAIEHVLARRHSIAA. 129
8 -63.9003dge_C mol:protein length:122 Response regulator  ali model follow..  17  2.....SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEED-ESLALSLGARKVMRKPFSPSQFIEEVKHLLNE....... 122
9 -62.6002zay_A mol:protein length:147 Response regulator receiver protein  ali model follow..  17  3LAEGKWWRIMLVDTQLPALAASISALSQEGFDIIQCGNAIEAVPVAVKTHPHLIITEANMPKISGMDLFNSLKKNPQTASIPVIALSGRATAKE-EAQLLDMGFIDFIAKPVNAIRLSARIKRVLKLLYEDLSA 135
10 -62.6003cnb_A mol:protein length:143 DNA-binding response regulator, merR family  ali model follow..  18  3LNVKNDFSILIIEDDKEFADMLTQFLENPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFSICHRIKSTPATANIIVIAMTGALTDDN-VSRIVALGAETCFGKPLNFTLLEKTIKQLVEQKKATSEG 137
11 -62.4003n53_A mol:protein length:140 Response regulator receiver modulated diguany  ali model follow..  14  1...MSLKKILIIDQQDFSRIELKNFLD-SEYLVIESKNEKEALEQIDHHHPDLVILDMDIIGENSPNLCLKLKRSKGLKNVPLILLFSSEHKEA-IVNGLHSGADDYLTKPFNRNDLLSRIEIHLRTQNYYSD. 128
12 -62.1001mvo_A mol:protein length:136 PhoP response regulator  ali model follow..  20  3.....NKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLDGIEVCKQLRQQK--LMFPILMLTAKDEEFD-KVLGLELGADDYMTKPFSPREVNARVKAILRRSEIRAP. 127
13 -61.9003gt7_A mol:protein length:154 Sensor protein  ali model follow..  20  4..SNRAGEILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRPDLIISDVLMPEMDGYALCRWLKGQPDLRTIPVILLTILSDPRD-VVRSLECGADDFITKPCKDVVLASHVKRLLSGVKRTEE. 133
14 -61.9002qzj_A mol:protein length:136 Two-component response regulator  ali model follow..  20  1..MSLQTKILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRNVT---TCPIVYMTYINEDQS-ILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNSYVN. 127
15 -61.5001p6q_A mol:protein length:129 CheY2  ali model follow..  23  1MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRAL-VQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK..... 129
16 -61.3002j48_A mol:protein length:119 TWO-COMPONENT SENSOR KINASE  ali model follow..  22  2......GHILLLEEEDEAATVVCEMLTAAGFKVIWLVDGSTALDQLDLLQPIVILMAWPPPDQSCLLLLQHLREHQADPHPPLVLFLGEPPVDP----LLTAQASAILSKPLDPQLLLTTLQGLCPP....... 118
17 -61.2001m5t_A mol:protein length:124 cell division response regulator DivK  ali model follow..  20  1.....TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVAVTAFAMKGD-EERIREGGCEAYISKPISVVHFLETIKRLLERQPA.... 124
18 -61.2003lte_A mol:protein length:132 Response regulator  ali model follow..  25  1MSLKQSKRILVVDDDQAMAAAIERVLKRDHWQVEIAHNGFDAGIKLSTFEPAIMTLDLSMPKLDGLDVIRSLRQN-KVANQPKILVVSGLDKAK-LQQAVTEGADDYLEKPFDNDALLDRIHDLVNE....... 125
19 -61.0003nhm_A mol:protein length:133 Response regulator  ali model follow..  24  1..MSLKPKVLIVENSWTMRETLRLLLS-GEFDCTTAADGASGLQQALAHPPDVLISDVNMDGMDGYALCGHFRSEPTLKHIPVIFVSGYAPRTEG--PADQPVPDAYLVKPVKPPVLIAQLHALLARAEAE... 126
20 -60.4002zwm_A mol:protein length:130 Transcriptional regulatory protein yycF  ali model follow..  22  2.....DKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKKY---DMPIIMLTAKDSEID-KVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTLE.. 124
21 -60.0001xhe_A mol:protein length:123 Aerobic respiration control protein arcA  ali model follow..  20  1...MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLARELREQA---NVALMFLTGRDNEVD-KILGLEIGADDYITKPFNPRELTIRARNLLSRTMQ.... 123
22 -59.8001nxo_A mol:protein length:120 DNA-binding response regulator  ali model follow..  22  1.....MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTS---SVPILMLSAKDSEFD-KVIGLELGADDYVTKPFSNRELQARVKALLRRSQ..... 120
23 -59.7001e6k_A mol:protein length:130 CHEMOTAXIS PROTEIN CHEY  ali model follow..  20  1MRSDKELKFLVVADFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 129
24 -59.7001ymu_A mol:protein length:130 CHEY  ali model follow..  20  1MRSDKELKFLVVDDFSTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 129
25 -59.6001zh2_A mol:protein length:121 KDP operon transcriptional regulatory protein  ali model follow..  28  1.....MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQ---WSAVPVIVLSARSEESD-KIAALDAGADDYLSKPFGIGELQARLRVALRRHSQ.... 121
26 -59.4001zgz_A mol:protein length:122 TorCAD operon transcriptional regulatory prot  ali model follow..  22  2.....PHHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLTRALRERS---TVGIILVTGRSDRID-RIVGLEMGADDYVTKPLELRELVVRVKNLLWRIDQ.... 122
27 -59.1003cfy_A mol:protein length:137 Putative LuxO repressor protein  ali model follow..  21  1..MSLRPRVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVLDWINQND--IPTSVIIATAHGSVDL-AVNLIQKGAEDFLEKPINADRLKTSVALHLKRAKLEDL. 128
28 -58.9002gkg_A mol:protein length:127 response regulator homolog  ali model follow..  20  1.GSHMSKKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFA--QHRKLKAHADEYVAKPVDADQLVERAGALIGFPE..... 127
29 -58.5003snk_A mol:protein length:135 Response regulator CheY-like protein  ali model follow..  17  9VTPTKRKQVALFSSDPNFKRDVATRLDLAIYDVRVSETDDFLKGPPADTRPGIVILDLGGGDLLGKPGIVEARAL--WATVPLIAVSDELTSEQ-TRVLVRMNASDWLHKPLDGKELLNAVTFHDTGNQ..... 135
30 -58.4002jvk_A mol:protein length:132 Sporulation initiation phosphotransferase F  ali model follow..  19  1...MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIAKRMKVID--ENIRVIIMTAYGELDM-IQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSNLE.. 126
31 -58.4003RVJ Entity 1(prereleased)  ali follow..  19  6...DKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAQAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 131
32 -58.3003crn_A mol:protein length:132 Response regulator receiver domain protein, C  ali model follow..  19  1...MSLKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFDIKLPDMEGTELLEKAHKLR--PGMKKIMVTGYASLEN-SVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEKEG.. 126
33 -58.3003f7n_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  3....KELKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELLKTIRADGAMSALPVLMVTALAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
34 -58.3003q15_C mol:protein length:126 Sporulation initiation phosphotransferase F  ali model follow..  19  1.GSMMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDM-IQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN.... 126
35 -58.1003TO5 Entity 1(prereleased)  ali follow..  20  9..LNKNMKILIVDDFSTMRRIVKNLLRDLGFNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQ-IIEAAQAGVNGYIVKPFTAATLKEKLDKIFER....... 133
36 -58.0003fft_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  3....KELKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTARAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
37 -58.0001e6m_A mol:protein length:128 CHEMOTAXIS PROTEIN CHEY  ali model follow..  19  1..SDKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISAWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
38 -58.0002jvi_A mol:protein length:132 Sporulation initiation phosphotransferase F  ali model follow..  19  1...MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDM-IQESKELGALTAFAKPFDIDEIRDAVKKYLPLKSNLE.. 126
39 -58.0003ffx_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  3....KELKFLVVDDESTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWRMPNMDGLELLKTIRADGAMSALPVLMVTAHAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
40 -58.0002jvj_A mol:protein length:132 Sporulation initiation phosphotransferase F  ali model follow..  19  1...MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVID--ENIRVIIMTAYGELDM-AQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSNLE.. 126
41 -58.0003ffw_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  3....KELKFLVVDDQSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
42 -57.9001ymv_A mol:protein length:129 CHEY  ali model follow..  20  3...DKELKFLVVDDGGTGRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 128
43 -57.9001hey_A mol:protein length:128 CHEY  ali model follow..  19  3....KELKFLVVGNGGTGKSTVRNLLKELGFNVEDAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
44 -57.9001djm_A mol:protein length:129 CHEMOTAXIS PROTEIN Y  ali model follow..  20  3...DKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 128
45 -57.8001ab5_A mol:protein length:125 CHEY  ali model follow..  20  1.....ELKFLVVDDNSTMRRITRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 124
46 -57.8001ab6_A mol:protein length:125 CHEMOTAXIS PROTEIN CHEY  ali model follow..  20  1.....ELKFLVVDDNSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMTTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 124
47 -57.8003lua_A mol:protein length:140 Response regulator receiver protein  ali model follow..  15  1..MSLDGTVLLIDYFEYEREKTKIIFDNIGYDFIEVENLKKFYSIFKDDSITLIIMDIAFPEKEGLEVLSAIRNNSRTANTPVIIATKSDNPGY-RHAALKFKVSDYILKPYPTKRLENSVRSVLKICQRFREG 134
48 -57.7002id7_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  3....KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISCWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
49 -57.6001udr_A mol:protein length:129 CHEY PROTEIN  ali model follow..  20  3...DKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEADAEN-IKALAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 128
50 -57.6006chy_A mol:protein length:128 CHEY  ali model follow..  21  3....KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKEN-IIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLG..... 127
51 -57.6002fka_A mol:protein length:129 Chemotaxis protein cheY  ali model follow..  20  4....KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 128
52 -57.6001u8t_A mol:protein length:128 Chemotaxis protein cheY  ali model follow..  20  3....KELKFLVVDKFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKEN-IIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLG..... 127
53 -57.5001jbe_A mol:protein length:128 Chemotaxis protein CHEY  ali model follow..  20  3....KELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRANXAMSALPVLMVTAEAKKEN-IIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG..... 127
54 -56.8003eod_A mol:protein length:130 Protein hnr  ali model follow..  21  5...LVGKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNRG--DQTPVLVISATENMAD-IAKALRLGVEDVLLKPVKDNRLREMVFACLYPSM..... 128
55 -56.8003i42_A mol:protein length:127 Response regulator receiver domain protein (C  ali model follow..  32  1...MSLQQALIVEDYQAAAETFKELLEMLGFQADYVMSGTDALHAMSTRGYDAVFIDLNLPDTSGLALVKQLRALPMEKTSKFVAVSGFAKND--LGKEACELFDFYLEKPIDIASLEPILQSIE......... 120
56 -56.6003gwg_A mol:protein length:129 Chemotaxis protein cheY homolog  ali model follow..  18  3...LGSMKLLVVDDSSTMRRIIKNTLSRLGYEVLEAEHGVEAWEKLDANDTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAE-VITALKAGVNNYIVKPFTPQVLKEKLEVVLGTND..... 129
57 -56.2002pkx_A mol:protein length:121 Transcriptional regulatory protein phoP  ali model follow..  23  2.......RVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHIPDIAIVDLGLPDEDGLSLIRRWRSND--VSLPILVLTARESWQD-KVEVLSAGADDYVTKPFHIEEVMARMQALMRRNSQ.... 121
58 -56.0003a0r_B mol:protein length:116 Response regulator  ali model follow..  20  1.....MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKK--KDAKIILLTAYSHYRS---DMSSWAADEYVVKSFNFDELKEKVKKLLS........ 116
59 -56.0002b4a_A mol:protein length:138 BH3024  ali model follow..  15  5.KIMQPFRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRSQSTCDLLIVSDQLVDLSIFSLLDIVKEQT--KQPSVLILTTGRHELIESS-----HNLSYLQKPFAISELRAAIDYHKPSMGVTMN. 131
60 -55.7002qxy_A mol:protein length:142 Response regulator  ali model follow..  18  1..MSLTPTVMVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDV-FEGEESLNLIRRIREE--FPDTKVAVLSAYVDKDL-IINSVKAGAVDYILKPFRLDYLLERVKKIISSTPRVTVS 128
61 -55.3002oqr_A mol:protein length:230 Sensory transduction protein regX3  ali model follow..  24  2...AMATSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVCKQLRARS---SVPVIMVTARDSEID-KVVGLELGADDYVTKPYSARELIARIRAVLRRGGDDDS. 127
62 -54.9003r0j_A mol:protein length:250 POSSIBLE TWO COMPONENT SYSTEM RESPONSE TRANSC  ali model follow..  23  19.NTTPEARVLVVDDEANIVELLSVSLKFQGFEVYTATNGAQALDRARETRPDAVILDVMMPGMDGFGVLRRLRADG--IDAPALFLTARDSLQD-KIAGLTLGGDDYVTKPFSLEEVVARLRVILRRAGKGNK. 147
63 -54.8002gwr_A mol:protein length:238 DNA-binding response regulator mtrA  ali model follow..  25  5.....RQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADS---GVPIVMLTAKTDTVD-VVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPA. 128
64 -54.5003hdv_A mol:protein length:136 Response regulator  ali model follow..  26  4..VAARPLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLYQKRIGLMITDLRMQPESGLDLIRTIRASER-AALSIIVVSGDTDVEE-AVDVMHLGVVDFLLKPVDLGKLLELVNKELKIGE..... 129
65 -54.1003hdg_A mol:protein length:137 uncharacterized protein  ali model follow..  18  9.......KILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLHAPDVIITDIRMPKLGGLEMLDRIKAGG--AKPYVIVISAFS-EMKYFIKAIELGVHLFLPKPIEPGRLMETLEDFRHIKLAKEG. 131
66 -54.0003rqi_A mol:protein length:184 Response regulator protein  ali model follow..  21  3.GSMSDKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVDLHLGNDSGLSLIAPLCDLQ--PDARILVLTGYASIAT-AVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEA. 131
67 -52.8003q9s_A mol:protein length:249 DNA-binding response regulator  ali model follow..  29  26MGRMNEQRILVIEDDHDIANVLRMDLTDAGYVVDHADSAMNGLIKAREDHPDLILLDLGLPDFDGGDVVQRLRKNS---ALPIIVLTARDTVEE-KVRLLGLGADDYLIKPFHPDELLARVKVQLRQRTSE... 152
68 -52.4001ys6_A mol:protein length:233 Transcriptional regulatory protein prrA  ali model follow..  24  3.TGVTSPRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAMD--NDVPVCVLSARSSVDD-RVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSTAT. 131
69 -52.2002l82_A mol:protein length:162 DESIGNED PROTEIN OR32  ali model follow..  13  24.RQGVRVVLLYSDQDEKRRRERLEEFEKQGVDVRTVEDKEDFRENIREPQLDVVVIVTTDDKEWIKDFIEEAKERG---VEVFVVYNNKDDDRR-KEAQQEFRSDGVVRTVSDKEELIEQVRRFVRKVGSLE.. 156
70 -51.9003h5i_A mol:protein length:140 Response regulator/sensory box protein/GGDEF  ali model follow..  20  3...LKDKKILIVEDSKFQAKTIANILNKYGYTVEIALTGEAAVEKVSGGYPDLILMDIELGGMDGVQTALAIQQ---ISELPVVFLTAHTEPAV-VEKIRSVTAYGYVMKSATEQVLITIVEMALRLYEANVH. 130
71 -51.5003heb_A mol:protein length:152 Response regulator receiver domain protein (C  ali model follow..  19  1..MSLSVTIVMIEDDLGHARLIEKNIRRAGVEIIAFTDGTSALNYLFGDRAQLVLLDLNLPDMTGIDILKLVKENPHTRRSPVVILTTTDDQREI-QRCYDLGANVYITKPVNYENFANAIRQLGLF....... 135
72 -51.4002l69_A mol:protein length:134 Rossmann 2x3 fold protein  ali model follow..  14  2.....NIVIVVFSTDEETLRKFKDIIKKNGFKVRTVRSPQELIEELVKKYNATIVVVVVDDKEWAEKAIRFVKSLG---AQVLIIIYDQDQNRL-EEFSREVRRRGFVRTVTSPDDFKKSLERLIREVGSLE.. 128
73 -51.1002qvg_A mol:protein length:143 Two component response regulator  ali model follow..  25  1MSLAADKDILYLEDDEVDIQSVERVFHKISIKIEIAKSGNQALDMLYGRHPKLILLDINIPKMNGIEFLKELRDDSSFTDIEVFVLTAAYTSKD-KLAFESLNIRGHLIKPLDYGEAIKLFWILQSM....... 135
74 -50.5003hzh_A mol:protein length:157 Chemotaxis response regulator (CheY-3)  ali model follow..  15  32.......NVLIVDDSVFTVKQLTQIFTSEGFNIITAADGEEAVIKYKNHYPDIVTLDITMPKMDGITCLSNIMEFD--KNARVIMISALGKEQL-VKDCLIKGAKTFIVKPLDRAKVLQRVMSVFVK....... 151
75 -50.3001k68_A mol:protein length:140 Phytochrome Response Regulator RcpA  ali model follow..  21  1....AHKKIFLVEDNKADIRLIQEALANSTVEVVTVRDGMEAMAYLRQERPDLILLDLNLPKKDGREVLAEIKSDPTLKRIPVVVLSTSINEDDI-FHSYDLHVNCYITKSANLSQLFQIVKGIEEF....... 131

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.