current user: public




Query: 3g67_A mol:protein length:213 Methyl-accepting chemotaxis protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst RIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETALast
1 -75.6003g67_A mol:protein length:213 Methyl-accepting chemotaxis protein  ali model  100  1RIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETA 213
2 -47.6002ch7_A mol:protein length:309 METHYL-ACCEPTING CHEMOTAXIS PROTEIN  ali model follow..  22  41NISTRIESISASVQETTAGSEEISSATKNIADSAQQAASFADQSTQLAKEAGDALKKVIEVAKDVERVVESFQKGAEEITSFVETINAIAEQTNLLALNAAIEAARAGEAGRGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITKLADEADEKLNSIVGAVERINEMLQNIAAAIEEQTAAVDEITTAMTENAKNAEEIT 267
3 -47.0004jpb_B mol:protein length:90 Methyl-accepting chemotaxis protein  ali model follow..  96  2...............................................................SHMSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLEN............................................................. 90
4 -38.0003zx6_A mol:protein length:341 HAMP, METHYL-ACCEPTING CHEMOTAXIS PROTEIN I  ali model follow..  22  56DVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLI-------EDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNA 275
5 -23.6004wjg_E mol:protein length:343 Haptoglobin-hemoglobin receptor  ali model follow..  11  78ANDTKAVKIIENITSARENLALFNNETQAVLTARDHVHKHRAAALQGWSDAKEKGDAAAEDVWEKCSRYSSSSTSETELQKAIDAAANVGGLNKFKLSNASVGAVRGGKHMEKVNNVAKLLKDAEVSLAAAAAEIEEVKNAHETKAQEEMKR-SETNSGGNAESQGNGDREDKNDEQQQVDEEETKVENGSSEEGSCCGNESNGPHVMKKRHG 332
6 -20.4005cws_D mol:protein length:227 Nucleoporin NUP49  ali model follow..  18KCIRDKEAVDAFLPAHGEQLAAIPTDVNFVTRKSEGAHNALSSDILAIDQLRELVKQDADNARLSFKAIDNLKLPMQYHQALWSKQMGGAGTAGASGASADADGQSNADLISYFSKTADEMEEMMKKFEKTITEIEAHLTGVEAHAMAMQNVAQSRNAAQGGVDERVYELAAVLREFEESILKVAGVVGGVKEGVTELQLR............ 220
7 -15.1005cwb_A mol:protein length:211 Designed helical repeat protein  ali model follow..  12  4.....EDECEEKARRVAEKVERLKRSGTSEDEIAEEVAREISEVIRTLKESGSSYEVICECVARIVAEIEALKRSGTSEDEIAEIVARVISEVIRTLKESGSSYEVICEC---VARIVAEIVEALKRSGTSEDEIAEIVARVISEVIRTLKSYEVIKECVQRIVEEIVEALKRSGTSEDEINEIVRRVKSEVERTLKESGS............ 201
8 -13.5004f7g_B mol:protein length:216 Talin-1  ali model follow..  23ECETAIAALNSCLRDLDQASLAAVSQQISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQFEPLTLAAVGAASKTLSHPQQMALLSALQLLYTAKAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDE................................................ 203
9 -12.2003dyj_A mol:protein length:332 TALIN-1  ali model follow..  118VLINAVKDVAKALGDLISATKAAAGKVGD-DPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKG---TRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLL--TLQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMK 330
10 -11.5004k1p_A mol:protein length:360 NheA  ali model follow..  12  119AYGKLQLQVQSIQENMEQDLLELNRFKTVLDKDSNNLSIKADEAIKTLQGSSGDIVKLREDIKRIQGEIQAELTTILNIKGSINIGKQVFTITNQTAQTKTIDFVSIGTLSNEIVNAAKELLPLIQKLSQTEAEATDQVSSFTELIDRQITTLETLLTDWKVLNNNMIQIQKNVEETYTDSSLLQKHFNQIKKVSDEMNKQTNQFEDYVTNV. 357
11 -10.1003vf0_A mol:protein length:283 Vinculin  ali model follow..  12  109..QPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVANLLQVCERIPTISTQLKILSTVKATMLGRTNI------------DEESEQATEMLVHNAQNLMQSVKETVREAEAAS........................................................ 262
12 -10.1002nrj_A mol:protein length:346 Hbl B protein  ali model follow..  11  115.....TGDGETLKEGITDLRGEIQQNQKYAQQLIEELTKLRDSIGHDVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESDGFNVMKGAIL-GIIVGVARDNLGKLEPLLAELRQTVDYVVGVAYSNINEMHKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKADQLKPNLNAAKDSWKTLRTDAVTLKEGIKEL. 337
13 -9.7204yxx_A mol:protein length:220 dTor_6x35L  ali model follow..  13  4......EQALKILKVAAELGTTVEEAVKRALKLKTKLGVSLEQALKILEVAAELGTTVEEAVKRALKLKTKLGVSLEQALKILEVAAKLGTTVE--AVKRALKLTKLGVSLEQALKILKVAAELGTTVEEAVKRALKLKTKLGVSLEQALKILEVAAELGTTVEEAVKRALKLKTKLGVSLEQALKILEVAAKLGTTVEEAVKRALKLKTKLG 210
14 -9.5503jbi_V mol:protein length:254 Vinculin  ali model follow..  12  85..QPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGNKRALIQCAKDIAKASDEVTRLAKEVANLLQVCERIPTISTQLKILSTVKATMLGRTN-----------ISDEESEQATEMLVHNAQNLMQSVKETVREAEAAS........................................................ 238
15 -9.2104e40_A mol:protein length:252 Putative uncharacterized protein  ali model follow..  12  20ELRAQLAGVSIASGILLRPAVIRNATTEFSRKKSEDILAKGGAAVERASAAVDRVSGLDKTNETAQKVRKAAAVAHHALEHVKEEVEIVAKKVNEIIELTAGATEHAKGAKANGDASAVKVSNLLARAKESENQYVKEAAEECSESTNYDVTAKSLAAALDKLPGVDNAVKTTFQSILTSLDNLDKDVKSVEQRAEELETALEKAERQLEKA. 233

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.