current user: public




3g67A
Query: 3g67_A mol:protein length:213 Methyl-accepting chemotaxis protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst RIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETALast
1 -70.1003g67_A mol:protein length:213 Methyl-accepting chemotaxis protein  ali model  100  1RIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETA 213
2 -50.1002ch7_A mol:protein length:309 METHYL-ACCEPTING CHEMOTAXIS PROTEIN  ali model follow..  22  48SISASVQETTAGSEEISSATKNIADSAQQAASFADQSTQLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTNLLALNAAIEAARAGEAGRGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEADEKLNSIVGAVERINEMLQNIAAAIEEQTAAVDEITTAMTENAKNAEEIT 267
3 -39.4003zx6_A mol:protein length:341 HAMP, METHYL-ACCEPTING CHEMOTAXIS PROTEIN I  ali model follow..  22  56DVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIE-------DSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNA 275
4 -18.5003dyj_A mol:protein length:332 TALIN-1  ali model follow..  105.AASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTK-GITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTPDLKQQLTGHSKRVAGSVTELIQAAEAMK 330
5 -15.3002x0c_A mol:protein length:309 TALIN-1  ali model follow..  67......GNLPEFGDAIATASKALCGFTEAAAQAA-YLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFAQCRAATAPLLEAVDNLSAFASNPEAAMEPIVISAKTMLESAGGLIQTASVLAGHSRTVSDSIKKLITSMRDKA 305
6 -14.7001sj8_A mol:protein length:308 Talin 1  ali model follow..  13  105EMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPQNLLQAAGNVGQASGELLQQIGESDTDPHFQDVLMQLANAVASAAAALVLKAKSVAQRTEDSGLQTQVIATQCALSTSQLVACTKVVAPTISS-----PVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHA....... 308
7 -10.0001kmi_Z mol:protein length:214 Chemotaxis protein cheZ  ali model follow..  19............................................................................ARIGSLTRMLRD--------SLRELGLDQAIAEAAEAIPDARDRLYYVVQMTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPID----LADARELVTDTRQFLADVPAHTSFTNAQLLKIMMAQD... 140
8 -9.2601st6_A mol:protein length:1069 Vinculin  ali model follow..  13  895..EAINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGNKRALIQCAKDIAKASDEVTRLAKEVTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAAS................................................................... 1048
9 -9.0101tr2_A mol:protein length:1066 VINCULIN ISOFORM 1  ali model follow..  13  892..EVINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKVCERIPTISTQLKIL---STVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAAS................................................................... 1045
10 -8.7902nrj_A mol:protein length:346 Hbl B protein  ali model follow..  11  116......GDGETLKEGITDLRGEIQQNQKYAQQLIEELTKLRDSIGHDVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESDGFNVMKGAILGLPIIG--GIIVGVARDNLGKLEPLLAELRQTVDYNINEMHKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKADQLKPNLNAAKDSWKTLRTDAVTLKEGIKEL. 337

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]