current user: public




Query: 3fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MAVSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHANGVPRGLELast
1 -127.0003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model  100  1MAVSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHANGVPRGLE 326
2 -110.0005e3p_A mol:protein length:302 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  65  1......TTASATGIATLTSTGDVLDVWYPEIGSTD--------------QSALTPLEGVDEDRNVTRKIVTTTI-DIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGTLSGGGQHVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLF-DGSLHKASTLAGSNGLIFRRDSVSGQVVAV-PNTKVVELNTALHSN....... 296
3 -105.0003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  48  2SHMSQSLFSLAFGVGTQNRQEAWLEVFYALPLLKPSSEIVAATFTSQQAYQLADALKGIDAAQSASQKPLVATLLAEDAAPSSTAEAYLKLHLLSHRLVKPHAVNLSGIFPLLPNVAWTNIGAVDLAELAELQLEARLKGKLEVFSVDKFPKMTDYVVPAGVRIADTARVRLGAYIGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTMGTLSGGGNIVISVGEGCLIGANAGIGIPLGDRNIVEAGLYITAGTKVALLDEKVVKARDLAGQPDLLFRRNSQNGAVECK-TNKTAIELNEALHAHN...... 347
4 -89.5002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  38  51INYEQNFGSAAIMLEAFMQRGVEIDFNASEFVQTLKLEDIDFALSCEEDGHQNIDLLKIIKDKFKDDEFSFVCL-FEDKEPLSVESIYLKLYLLSTKKVPLRSINLNGAFGLLSNVAWSDDKPIELEYLRANEMRLKMSNQPKIDFVDKFPRFLAHIIPENTRILESSKVRMGASLAAGTTIMPASYVNFNAGTTGACMVEGRISSSAIVGEGSDVGGGASILGVLSGTSGNAISVGKACLLGANSVTGIPLGDNCIVDAGIAVLEGTKFLLKDAEIYKGLELKGLNGLHFRQDSISGAMIVA-LNKKAVKLNEALH......... 387
5 -42.5003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  2...................................................SMQQLQNVIETAFERRADITPA--NVDTVTREAITHVIDLLDTGALRVAEKI-----------DGQWVTHQWLKKAVLLSFRIQVMEGAETRYY--DKVPYDEARFQREGFRVVPPATVRKGAFIARNTVLMP-SYVNIGAFVDEGTMVDTWATVGSCIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPAGSVVVSGNYSLYCAVIVKKKTRSKVGINELLRTID...... 276
6 -42.4001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  19  1....................................................MQQLQNVIESAFERRADITPA--NVDTVTREAVNQVIGLLDSGALRVAEKI-----------DGQWVTHQWLKKAVLLSFRIKVMDGAETRYY--DKVPYDEARFQKEGFRVVPPATVRQGAFIARNTVLMP-SYVNIGAYVDEGTMVDTWATVGSCIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNYSLYCAVIVKKKTRGKVGINELLRTID...... 274
7 -42.3003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  19  5...................................................GSQQLQNIIETAFERRAEITPA--NADTVTREAVNQVIALLDSGALRVAEKI-----------DGQWVTHQWLKKAVLLSFRIQVIEGAESRYF--DKVPYDEARFQKEGFRVVPPAAVRQGAFIARNTVLMP-SYVNIGAYVDEGTMVDTWATVGSCIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPAGSVVVSGNYSLYCAVIVKKKTRGKVGINELLRTID...... 279
8 -41.6003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  17  43....................................................SQQLQQIIDNAWENRAELSP--KAASAEIREAVAHAIEQLDRGALRVAEKI-----------DGAWTVHQWLKKAVLLSFRLEDNAPAGGYSQFYDKVPYTAEDFAAGGFRVVPPAIARRGSFIAKNVVLMP-SYTNIGAYVDEGTMVDTWATVGSCIGKNVHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNHSLYCAVIVKKKTRAKVGLNELLRGD....... 316
9 -41.3003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  8........................................AQTQGPSMTKPDLASLEKTIEKAFDERDGINT---ATRGEVREAVEQSLILLDRGEVRVAEKQ----------ADGNWHVNQWLKKAVLLSFRLEVIKGGPGQSSWWDKVPWTANEFEKAGFRAVPNCIVRHSAYIAPNAILMP-SFVNLGAYVDKGAMIDTWATVGSCIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTPSLYCAVIVKEKTRSKTSINELLRD........ 298
10 -32.7003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  87............................................................................................................................................................LKGIKARIEPGAIIRDHVEIGDNAVIMMNATINIGAVIGEGSMIDMNAVLGATVGKNCHVGAGAVLAGVIEPPSAKPVIVEDDVVIGANVVVGVTVGKGAVVAAGAVVTPYTVVAGTPARVIKEID---------------------EKTKAKTEIKQELRQLNPEK... 240
11 -32.1003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  87............................................................................................................................................................LKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVGVRVGEGAVVAAGAVVPAHTVVAGVPAKVIKQID---------------------DKTKSKTEILEELRK........ 235
12 -13.3004m98_A mol:protein length:208 Pilin glycosylation protein  ali model follow..  17  94...................................................................................................................................................................IHPDATVSPSAIIGQGSVVMAKAVVQAGSVLKDGVIVNTAATVDCLLDAFVHISPGAHLSGN--------TRIGEESRIGTGACSQTTVGSGVTAGAGAVIVCD........................................................... 193
13 -13.2003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  13  32..........................................................................................................................................................NVLISKKASIYNPGVISIGNNVRIDDFCILSGKVTIGSYSIAAYTALYGGEVGIEMYDFANISSRTIVYAAYKNVKTGKVILKKHVIIGAHSIINVVIGEGVAVGAMSMVKESLD......................................................... 166
14 -12.7004ea7_A mol:protein length:220 Perosamine N-acetyltransferase  ali model follow..  22  102...................................................................................................................................................................IHPSAVVSPSVRLGEGVAVMAGVAINADSWIGDLAIINT-VDHDCRLGAACHLGPASALAGG--------VSVGERAFLGVGARVGVTIGADTIVGAGGVVVRD........................................................... 201
15 -12.2003tv0_A mol:protein length:194 Dynactin subunit 6  ali model follow..  11  15.............................................................................................................................................................IAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIEGNLIEEQALIIMIIGTNNVFEVGCYSQAM---------KMGDNNVIESKAYVNVILTSGCIIGACCNLNTFEVI........................................................ 141
16 -12.2003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  25  81............................................................................................................................................................LIHKSALISPSAIVEEN----AGILIMPYVVINAKAKIEKGVILNT-IEHECVIGEFSHVSVGAKCAGN--------VKIGKNCFLGINSCVNLSLADDSILGGGATLVKNQD......................................................... 185
17 -12.2005adx_U mol:protein length:190 DYNACTIN 5  ali model follow..  11  11.............................................................................................................................................................IAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIEGNLIEEQALIPMIIGTNNVFEVGCYSQAM---------KMGDNNVIESKAYVNVILTSGCIIGACCNLNTFEVI........................................................ 137
18 -12.1002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  25  80............................................................................................................................................................LIHKSALISPSAIVEEN----AGILIMPYVVINAKAKIEKGVILNT-IEHECVIGEFSHVSVGAKCAGN--------VKIGKNCFLGINSCVNLSLADDSILGGGATLVKNQD......................................................... 184
19 -12.1005afu_U mol:protein length:168 DYNACTIN  ali model follow..  11  2............................................................................................................................................................................GAVVCVESEIRGDVTIGPRTVIHPKARIIA--AGPIVIGEGNLIEEQALIINAYPDNTEKPMIIGTNNVFEVGCYSAMKMGDNNVIESKAYVGRNVILIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPTLQLDF.............. 149
20 -11.9003fs8_A mol:protein length:273 QdtC  ali model follow..  12  88..........................................................................................................................................................DTIIGDNFQTGHKVTIRENTKIGNNVKIGTLSDIQHHVYIGNYVNIHS-VGEKSIIKDFVWLFPHVVLTNDPTPPSNELVTIELFAVIAARSVVGIHINEDALVGAGAVVTKDVP......................................................... 208
21 -11.5003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  15  29........................................................................................................................................................................SVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDK-IEVGEGTNIQDNTVVHTDSMH---GDTVIGKFVTIGHSCILACTLGNNAFVGMGSIVMDRAVM--EEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILYLQKS........ 173
22 -11.5003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  15  35........................................................................................................................................................................EIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQG--HGPAYIGDGCFIGFRSTVNARVGAGCVVMMHVLIQDVE.......................................................... 159
23 -11.4004m9c_A mol:protein length:216 Bacterial transferase hexapeptide (Three repe  ali model follow..  15  94...................................................................................................................................................................QSTNTVILDEVEIGEGSLLCPFTCLTSNIKIGKFFHANIYSYVACVIGDYVTFAPGAKCNGN--------IHIEDHAYIGTGAVI-LIIGKGAIVGMGAVVTKSVP......................................................... 200
24 -11.1001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  13  10......................................................................................................................................................................KPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRG--IEQIYVGKYSNVQDNV----SIHTSHGYPTEIGEYVTIGHNAMVGAKVGNYVIIGISSVILDGAKI---DHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEWTKKN........ 155
25 -11.0003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  11  12........................................................................................................................................................................QIAASAFIADYVTITGDVVIGEETSIWFNTVIRGDVAP-TVIGNRVNIQDNS----ILHQSPNNPLIIEDGVTVGHQVILSAIVRKNALIGMGSIILDRAEI---EGAFIGAGSLVPPGKKIPPNTLALGRPAKVVRELTEDDIREMERI........ 155
26 -10.9004mfg_A mol:protein length:168 Putative acyltransferase  ali model follow..  12  14........................................................................................................................................................................LIDESVFVAKSADVIGNVKIGKDSSIWYNAVVRGDEGP-ITIGENTNIQDCSIV-------GDTETIIGNNVTVGHRSIVGCKISDNVLIGMGSIILDNAEI---EYTLIGAGTLITSNKKFPPGVLIMGSPGKVVRELTEEDKKYIDES........ 155
27 -10.9001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  14  14........................................................................................................................................................................KIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVSP-TIIGDRVNVQDQC----TLHQSPQYPLILEDDVTVGHQVILSCHIKKDALIGMGSIILDGAEI---EGAFIGAGSLVSQGKKIPPNTLAFGRPAKVIRELTAEDRKDM........... 154
28 -10.8004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  15  13.............................................................................................................................................................IGDNTKVWQFCVILAGAVIGRNCNICANSLIENDVVIGDNVTIKSGVQIGIHIQDDVFIGPNVTFTNDKQPRSKLKTIVKKGASIGANSTIGILIGENAMVGAGAVITKNVP......................................................... 134
29 -10.7003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  13  21........................................................................................................................................................................KLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHH-IRIGARTSVQDGSVLHITHASDGGYPLIIGDDVTIGHQAMLGCTIGNRVLIGMKSMIMDGAIV--EDEVIVAAGATVSPGKVLESGFVYMGTPAKKVRPITEKERSFFTYG........ 171
30 -10.6005adx_V mol:protein length:165 DYNACTIN SUBUNIT 6  ali model follow..  12  2............................................................................................................................................................................GNKVSRQSVLCGSQNIVLNGKTI-DCIIRGDLAN-VRVGRHCVVKSRSVIRPPFKKFSKGPLHIGDHVFIEEDCVVAAQIGSYVHVGKNCVIGRRCVL--KDCCKILDNTVLPPETVVPPFTVFSGC........................... 132
31 -10.6001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  16  61........................................................................................................................................................................VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETIGKEYAVYIGNNVSLAHQSQVPAAVGDDTFIGMQAFVFKSK---VGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLP............... 217
32 -10.4003tio_A mol:protein length:183 Protein YrdA  ali model follow..  15  13........................................................................................................................................................................QIGQRVMIDDSSVVIGDVRLADDVGIWPLVVIRGDVHY-VQIGARTNIQDGSMLHVTHKSSDGNPLTIGEDVTVGHKVMLGCTIGNRVLVGMGSILLDGAIV--EDDVMIGAGSLVPQNKRLESGYLYLGSPVKQIRPLSDEEKAGLRYS........ 163
33 -10.3003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  15  17........................................................................................................................................................................GIGQRVMIDTSSVVIGDVRLADDVGIWPLVVIRGDVNY-VAIGARTNIQDGSVLHVTHKSSHGNPLIIGEDVTVGHKVMLGCTIGNRVLVGMGSIVLDGAII--EDDVMIGAGSLVPQHKRLESGYLYLGSPVKQIRPLSDAERSGLQYS........ 167
34 -10.2003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  18  18.............................................................................................................................................................IGAHSRIWHWVHICGGAEIGEGCSLGQNVFVGNRVRIGNRVKIQNNVSVNVFLEDDVFCGPSMVFTNVYNPRAARDTIVRQGATLGANCTVGATIGRYAFVGAGAVVNKDVP......................................................... 140
35 -10.2004n27_A mol:protein length:195 Bacterial transferase hexapeptide repeat  ali model follow..  17  26....................................................................................................................................................QFADRESNWIAPDATLIGKVVVGENAGFWFGAVLRGDN-IGADTNVQEQTIMHTDIGFPLTIGAGCTIGHRAILHGC---------TIGENTLIGMGAIVGAKVGKNCLIGAGTLVKEGMEI........................................................ 143
36 -10.2003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  20  53.....................................................................................................................................................LNQLLGSSADGKAQINPDFRCDYGYNIHVGKSF----FANFNCVILDVCEVR--------IGDHCMFAPGVHIYTATHPLHGKPVKIGNNVWVGGGAIIGVSIGDNAVIASGAVVTKD........................................................... 170
37 -10.1003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  17  59.............................................................................................................................................................LGHKSCVQPPFHCEFGKTIRIGDHT----FINMNVVMLDGAPIT--------IGDHVLIGPSTQFYTASHSLDCKPIVIEDDVWIGGNVVIGVTIGARSVVAANSVVNQD........................................................... 168
38 -10.0002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  18  8...............................................................................................................MLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSRLFIEPNFRCDYGYNIHVGENF----FMNFDGVILDVCEVR--------IGDHCFIGPGVHIYTATHPLDGKPVVIGHNVWIGGRAVIGVTIGDNAVIASGAVVTKD........................................................... 166
39 -9.7701ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  15  7...............................................................................................................MIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQEAYIEPTFRCDYGYNIFLGNNF----FANFDCVMLDVCPIR--------IGDNCMLAPGVHIYTATHPIDGKPVTIGNNVWIGGRAVIGVTIGDNVVVASGAVVTKD........................................................... 164
40 -9.7303srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  17  10...............................................................................................................MLSGKGYYANDELLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGSQINVEQNIRCDYGYNIHVGENF----FANYDCIFLDVCKIE--------IGDNVMLAPNVQIYTAYHPIDGSPVKIGDNVWIGGGVIIGITIGDNVVIGAGSVVTKD........................................................... 168
41 -9.6501kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  15  1.......................................................................................................MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMVGENAWVEPPVYFSYGSNIHIGRNF----YANFNLTIVDDYTVT--------IGDNVLIAPNVTLSVTGHPVHHEPITIGNNVWIGSHVVIGVTIGDNSVIGAGSIVTKD........................................................... 167
42 -9.5304fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  18  161.ASDAQREINEINTGILVANGRDLKRWLSLLDNNNAQGEFYITDIIALAHADGKKIATVHPTRLSEVEGVNNRLQLSALERVFQTEQAEKLLLAGVMLLDPSRFDLRGELTH-TNVIIEGHVILGDRVRIGTGCVLKNCVIGDDSEISPYTVLEDARLDANCTVGPFARLRPGAELAEGAHV--GNFVEIKKARLGKGSKAGHLSGDAEIGAGVNIGAG-TITCNYDGANKFKTIIGDDVFVGSDTQL-VTVANGATIGAGTTVTRDVAENELVISRVKQVHIQG......................................... 451
43 -9.4901hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  17  158.ATDEQRQIQEINTGILIANGADMKRWLAKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVMLRDPARFDLRGTLTH-TNVIIEGNVTLGHRVKIGTGCVIKNSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHV--GNFVEMKKARLGKGSKAGHLTGDAEIGDNVNIGAG-TITCNYDGANKFKTIIGDDVFVGSDTQL-VTVGKGATIAAGTTVTRNVGENALAISRVPQTQKEG......................................... 448
44 -9.4602v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  14  158.ANAEQLNIKEVNTGVMVSDGASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALERYFQNKQASKLLLEGVMIYDPARFDLRGTLEH-VNVIIEGNVKLGDRVKIGTGCVLKNVVIGNDVEIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHV--GNFVEIKKSTVGKGSKVNHLTGDSEIGSNCNIGAG-VITCNYDGANKFKTIIGDDVFVGSDTQL-VKVANGATIGAGTTITRDVGENELVITRVAQRHIQG......................................... 448
45 -9.4303v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  20  60.............................................................................................................................................................TTDNVSISIPFDTDYGWNVKLGKNV----YVNTNCYFMDGGQIT--------IGDNVFIGPNCGFYTATHPLNAGPIHIGSNTWFGGHVAVGVTIGEGSVIGAGSVVTKD........................................................... 169
46 -9.3803c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  13  71FKNSSLAGSYLLGRVNVLHS-----ALYKSDIRGDELKRKGQHFVCDGKMIPLHD----DEVITIKDSFLNKTLVHSNSHDPESPEEFTIRNTVAMPYANIHGSLTEGSF-VVRYFSYVQTGELVGKCVEPGQIWIKSGDELEFH-LDKYISQEAGSCPTGVHMASGAGSASGASVSGYAVIKGDTVIGENVLVKGSNAQENCYIINSRLERNCVTAHGGKIINA---------HLGDMIFTGFNSFLPLKIGDGCVVMPHTIIDLEEPLEIPAGHLVKVDGEVTMGRMTFRGKGGPFLDSFKKRIKRILSENGAFFDGSEGTG.. 454
47 -9.3104dcl_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  20  57.............................................................................................................................................................TTDNVSISIPFDTDYGWNVKLGKNV----YVNTNCYFMDGGQIT--------IGDNVFIGPNCGFYTATHPLNAGPIHIGSNTWFGGHVAVGVTIGEGSVIGAGSVVTKD........................................................... 166
48 -9.3004egg_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  20  57.............................................................................................................................................................TTDNVSISIPFDTDYGWNVKLGKNV----YVNTNCYFMDGGQIT--------IGDNVFIGPNCGFYTATHPLNAGPIHIGSNTWFGGHVAVGVTIGEGSVIGAGSVVTKD........................................................... 166
49 -9.2202ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  11  119IIGVKVSNPKDYGVLVLDNQNNLSKIIEKPEIPPSNLINAGIYKLNSDIFTYLDKISISERGELELTDAINLMAKDHRVKVIEYEGYWMDI---PWNIIDVNKWALDNLVFSQNLGNVEDNVKIKGKVIIEEDAEIKSGTYIE-----------PVYIGKGSEIGPNSYLRPYTILVEKNKIGASVEVKESVIMEGSKIPHLSYVGDSVIAEDVNFGAGTLIANISSGRRKLGAFIGGHVRTGINVTIGVKIGAYARIYPGAVVNRDVG......................................................... 394

FFAS is supported by the NIH grant R01-GM087218-01
8 3 0 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.