current user: public




Query: 3fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MAVSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHANGVPRGLELast
1 -128.0003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model  100  1MAVSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLLGANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEVLARDGQGIALNEDLHANGVPRGLE 326
2 -100.0003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  47  3.HMSQSLFSLAFGVGTQNRQEAWLEVFYALPLLKPSSEIVAAVAPILGYAAGNQALSALLSRLAESQKPLVATLLAEDAAPSSTAEAYLKLHLLSHRLVKPHAVNLSGIFPLLPNVAWTNIGAVDLAELAELQLEARLKGKLEVFSVDKFPKMTDYVVPAGVRIADTARVRLGAYIGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTMGTLSGGGNIVISVGEGCLIGANAGIGIPLGDRNIVEAGLYITAGTKVALLDEQNVKARDLAGQPDLLFRRNSQNGAVEC-KTNKTAIELNEALHAHN...... 347
3 -84.7002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  38  51INYEQNFGSAAIMLEAFMQRGVEIDFNASEFVQTLKLEDIDFALSCEEDGHQNIDLLKIIKDKFKDD-EFSFVCLFEDKEPLSVESIYLKLYLLSTKKVPLRSINLNGAFGLLSNVAWSDDKPIELEYLRANEMRLKSNQYPKIDFVDKFPRFLAHIIPENTRILESSKVRMGASLAAGTTIMPGSYVNFNAGTTGACMVEGRISSSAIVGEGSDVGGGASILGVLSGTSGNAISVGKACLLGANSVTGIPLGDNCIVDAGIAVLEGTKFLLKDAEELAKLELKGLNGLHFRQDSISGAMIV-ALNKKAVKLNEALH......... 387
4 -54.6003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  16  1............GPGSMRRRRAAHRRFLPRPRPLNARAPIHSSSTSSIATNMSQQLQQIIDNAWENRAELS------PKAASAEIREAVAHAIEQLDRGALRVAEKI-------DGAWTVHQWLKKAVLLSFRLEDNAPMPYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKNVVLMP-SYTNIGAYVDEGTMVDTWATVGAQIGKNVHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVV--THSLYCAVIVDAKTRAKVGLNELLRGD....... 316
5 -49.0001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  17  1....................................................MQQLQNVIESAFERRADITPA----NVDTVTREAVNQVIGLLDSGALRVAE----------IDGQWVTHQWLKKAVLLSFRINDNKVMDGAETRMKFADYDEARFQKEGFRVVPPATVRQGAFIARNTVLM-PSYVNIGAYVDEGTMVDATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVV--SYSLYCAVIVDAKTRGKVGINELLRTID...... 274
6 -47.7003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  15  2................................................................KMMDANEIISFIQKSEKKTPVKVYIKGDLKEVTFPETVQAFVN------KKSGVLFGEWSEIKTILDENSKYIVDYVVENDRRNSAIPMLD-LKGIKARIEPGAIIRDHVEIGDNAVIMMNATINIGAVIGEGSMIDMNAVLGATVGKNCHVGAGAVLAGVIEPPSAKPVIVEDDVVIGANVVVGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPAR--------------------EIDEKTKAKTEIKQELRQLNPEK... 240
7 -47.5003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  15  2...................................................SMQQLQNVIETAFERRADIT------PANVDTVTREAITHVIDLLDTGALRVAE--------IDGQWVTHQWLKKAVLLSFRINDNQVMEGDKVPMKFAGYDEARFQREGFRVVPPATVRKGAFIARNTVLM-PSYVNIGAFVDEGTMVDATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFVGARSEVGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPASKDGSYSLYCAVIVKKVDAKTRSKVGINELLRTID...... 276
8 -46.5003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  15  5...................................................GSQQLQNIIETAFERRAEIT------PANADTVTREAVNQVIALLDSGALRVAE--------IDGQWVTHQWLKKAVLLSFRINDNQVIEGDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFIARNTVLM-PSYVNIGAYVDEGTMVDATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPASKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID...... 279
9 -45.9003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  15  4..................................................................MDAYEIIQYIGDAKKQTLVKVTLKGQLKEVTFPETIKVFNNCKTGTLFG-DWADVKPFLEANKEKIEDYVVE------NDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVVGAGTMIDMGAVLGATVGKHCHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAK--------------------QIDDKTKSKTEILEELRK........ 235
10 -39.9001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  12  1.......................................................................................................MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMVGENAWVEPPVYFSYGSNIH----IGRNFYANFNLTIVDDYTV--TIGDNVLIAPNVTLSVTGHPVHHELRMYSFPITIGNNVWIGSHVVIGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCRREINDRDKHYYFKDYKV............................. 199
11 -39.9003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  12  2.....................................................................................................NAMKMSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQSDEAERYALQRELFGHLGHKSCVQPPFHCEFGKTIR----IGDHTFINMNVVMLDGAPI--TIGDHVLIGPSTQFYTASHSLDYRRRTICKPIVIEDDVWIGGNVVIGVTIGARSVVAANSVVNQDVPPDTLVGGTPARRSLKDPAESMAE.................................. 195
12 -39.5001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  12  2..........................................................................................................TEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQEAYIEPTFRCDYGYNIF----LGNNFFANFDCVMLDVCPI--RIGDNCMLAPGVHIYTATHPIDPVARELGKPVTIGNNVWIGGRAVIGVTIGDNVVVASGAVVTKDVPDNVVVGGNPAR.............................................. 177
13 -39.4003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  14  1.....................................................................................................SNAMKTEKDKMLAGEMYIADDEELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSKAQINPDFRCDYGYNIH----VGKSFFANFNCVILDVCEV--RIGDHCMFAPGVHIYTATHPLHPVEREYGKPVKIGNNVWVGGGAIIGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAK.............................................. 183
14 -38.8003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  14  1......................................................................................................SNAMTEKEKMLSGKGYYANDELLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLVGKQINVEQNIRCDYGYNIH----VGENFFANYDCIFLDVCKI--EIGDNVMLAPNVQIYTAYHPIDAQLREYGSPVKIGDNVWIGGGVIIGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCR.............................................. 181
15 -38.7002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  15  1........................................................................................................MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELTGERLFIEPNFRCDYGYNIH----VGENFFMNFDGVILDVCEV--RIGDHCFIGPGVHIYTATHPLDPHEREYGKPVVIGHNVWIGGRAVIGVTIGDNAVIASGAVVTKDVPANAVVGGNPAK.............................................. 179
16 -37.9003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  12  1......................................................................................................SNAMTEKEKMLAEKWYDANDQYLINERARAKDICFELNHTRPSATNKRKELIDQLTTDNVSISIPFDTDYGWNVK----LGKNVYVNTNCYFMDGGQI--TIGDNVFIGPNCGFYTATHPLNFHHREKAGPIHIGSNTWFGGHVAVGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKRKIDNDLPSETLNDETI............................. 201
17 -35.8003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  17  5.....................................TLEAQTQGPSMTKPDLASLEKTIEKAFDERDGINTA---TRGEVREAVEQSLI--LLDRGEVRVAEKQADGNWHVNQWLKKAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA-PNAILMPSFVNLGAYVDKGAMIDTWATVGAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYENWGPSLYCAVIVKRADEKTRSKTSINELLRD........ 298
18 -31.3003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  10  14..............................................................................................................................................SFYSQEELKKIGFLSVGKNVLISKKASIYNPISIGNNVRIDDFCILSGKVTIGSYSHIGIEMYDFANISSRTIVYAAIDDFS-YKNVKTGKVILKKHVIIGAHSIINVVIGEGVAVGAMSMVKESLDDWYIYVGVPVR.............................................. 177
19 -30.5003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  16  18.............................................................................................................................................................IGAHSRIWHWVHICGGAEIGEGCSLGQNVFVGNRVRIGNRVKIQVSVYDNVFLEDDVFCGPSMVFTNVYNPRAARDTIVRQGATLGANCTVGATIGRYAFVGAGAVVNKDVPDFALVVGVPAR.............................................. 151
20 -30.3003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  10  1.......................................................................................MLRLKTQDSRLKTQDSRLKTQDSRLKTQDSFSVDDNDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFIHKNSKIKGDIVATKGSKV----IIGRRTTIGAGFEVTDKCNV--TIGHDCMIARDVILRASGHPIFDIHSKKAKDIIISSYVWVGRNVSIGVSVGSGSVIGYGSIVTKDVPSMCAAAGNPAKKRNIIWARTDKAELISDDKRCSSYHAK................... 241
21 -28.1003fs8_A mol:protein length:273 QdtC  ali model follow..  10  90............................................................................................................................................................IIGDNFQTGHKVTIRENTKIGNNVKIGTLSDIQHHVYIGNYVNIHVFVGEKSIIKDFVWLFPHVVLTNDPTPPSNEGVTIELFAVIAARSVVGIHINEDALVGAGAVVTKDVPKETVVVGNPARCSIRKIKNKITGEQVYPWRYTFKRGMPWEETDYDTWIKNISIENLE 267
22 -27.4002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model follow..  12  70...................................................................................................................................................................LVCSLHSDCSLQIQAKTT-----MGNGEITIAEKGKIS--IGKDCMLAHGYEINTDMHPIYSLENGEGKDVIIGNHVWLGRNVTIGVCIPNNVVVGSHTVLYKSFKENCVIAGSPAKKENIVWGRKMYHSTM............................... 204
23 -26.9003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  23  81............................................................................................................................................................LIHKSALISPSAIVEEN----AGILIMPYVVINAKAKIEKGVILNTSIEHECVIGEFSHVSVGAKCAG--------NVKIGKNCFLGINSCVNLSLADDSILGGGATLVKNQDEKGVFVGVPAK.............................................. 196
24 -26.6002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  23  80............................................................................................................................................................LIHKSALISPSAIVEEN----AGILIMPYVVINAKAKIEKGVILNTSIEHECVIGEFSHVSVGAKCAG--------NVKIGKNCFLGINSCVNLSLADDSILGGGATLVKNQDEKGVFVGVPAK.............................................. 195
25 -24.4001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  14  27................................................................................................................................................................................LENVEVGEYSYYDSKNGETFDKQIKLKIGKFCSIGPGVTINGANHRMDGST-PIKGDTIIGNDVWIGKDVVIGVKIGDGAIVAANSVVVKDIAPYMLAGGNPAN-------KQRFDQDTINQLLDIKWWNWPIDIINENIDK........ 195
26 -24.4001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  10  9...................................................................................................................................................FRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSF----DDCARYLMPDRDDVDKLV--IGSFCSIGSGAAFIMAGNQGHRAEWASTFPTLIGHEVWIGTEAMFGVRVGHGAIIGSRALVTGDVEPYAIVGGNPAR-------RKRFSDGDIQNLLEMAWWDWPLADIEALLCTGDIPALYQ 203
27 -23.6003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  10  23.....................................................................................................................................................................PNIIVGKHSYYSGYYHGHSFDDCVRYLHPERDDVDKLVIGSFCSIGSGAVFMMAGNQGHRSDWISTFPTIIGHDVWIGTEAMIGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAK-------KFRFSDVEIAMLLEMAWWNWPESWLKESLCSSDIEGLYL 204
28 -21.3003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  13  13.............................................................................................................................................................IAASAFIADYVTITGDVVIGEETSIWFNTVIR-RVNIQDNSILHQSPNNPLIIEDGVTVGHQVILHS---------AIVRKNALIGMGSIIRAEIGEGAFIGAGSLVPPGIPPNTLALGRPAKRELTEDDIREMERIRREYVEKGQYYKALQQQRTSCADKKELP.... 183
29 -20.0001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  12  13.............................................................................................................................................................IHPSAFVDENAVVIGDVVLEEKTSVWPSAVLR-YSNVQDNVSIHTSHGYPTEIGEYVTIGHNAMVHG---------AKVGNYVIIGISSVIGAKIGDHVIIGAGAVVPPNIPDYSLVLGVPGKRQLTEEEIEWTKKNAEIYVELAEKHIKGRKRI.............. 173
30 -19.7003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  136.............VHSNSHDPESPEEFTIRNTVAMPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSYVQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLMEFVEVRQEDFEEVFASGHMA----------SGAGSASGASVSGYAVIKGDTVIGENVLVSQRAYLD-NAWMGKGSNAQENCYIISRLERNCVTAHGGKIINA---------HLGDMIFTGFNSFLQLKIGDGCVVMPHTIIDLEIPAGHLVWGYIRNKADLAMGRMTFRGKGGPFLDSFKKRIKRILSENGAFFDGSEGTG.. 454
31 -19.6001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  15  15.............................................................................................................................................................IASSAFIADYVTITGDVYVGEESSIWFNTVIR-RVNVQDQCTLHQSPQYPLILEDDVTVGHQVILHS---------CHIKKDALIGMGSIIGAEIGEGAFIGAGSLVSQGIPPNTLAFGRPAKRELTAEDRKDMERIR............................... 158
32 -18.9003TV0 Entity 1(prereleased)  ali follow..  15.............................................................................................................................................................IAPGAVVCVESEIRGDVTIGPRTVIHPKAVIGEGNLIEEQALIINAYPDNMIIGTNNVFEVGCYSQA---------MKMGDNNVIESKAYVNVILTSGCIIGACCNLNTFIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVK...... 193
33 -18.4002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  119IIGVKVSNPKDYGVLVLDNQNNLSKIIEKPEIPPSNLINAGIYKLNSDIFTYLDKISISERGELELTDAINLMAKDHRVKVIEYEGYWMDI--KPWNIIDVNKWALDNLVFSQNLGNVEDNVKIKGKV----------------------------IIEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTILVEKNKIGASVEVDSVIAEDVNFGAGTLIANISSGRRKLGAFIGGHVRTGINVTIGVKIGAYARIYPGAVVNRDVGYGEFF.................................................... 399
34 -17.7003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  13  30.............................................................................................................................................................VDSTAFIAGNARIIGDVCIGKNASIWYGTVLR-GTNIQDNTVVHTDSMHGTVIGKFVTIGHSCILHA---------CTLGNNAFVGMGSIVRAVMEEGSMLAAGSLLTRGVKSGELWAGRPAKRMMTEEEILYLQKSA............................... 174
35 -16.7001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  13  128...................................................................................................................................................................LQNQISVAFDVDIHPAAKIGHGIMFDHATGIV--------VGETSVIENDVSILQGVTLGGTGKESGDRHPKVREGVMIGAGAKINIEVGKYAKIGANSVVLNPVPEYATAAGVPAR.............................................. 238
36 -16.7001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  13  130...................................................................................................................................................................LQNQISVAFDVDIHPAAKIGHGIMFDHATGIV--------VGETSVIENDVSILQGVTLGGTGKESGDRHPKVREGVMIGAGAKINIEVGKYAKIGANSVVLNPVPEYATAAGVPAR.............................................. 240
37 -16.6003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  17  22.............................................................................................................................................................LGERVFVDRSSVIIGDVELGDDCSVWPLAVIR-RTSVQDGSVLHIT-GYPLIIGDDVTIGHQAMLHG---------CTIGNRVLIGMKSMIGAIVEDEVIVAAGATVSPGLESGFVYMGTPAKRPITEKERSFFTYGA............................... 172
38 -16.6003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  17  18.............................................................................................................................................................IGQRVMIDTSSVVIGDVRLADDVGIWPLVVIR-RTNIQDGSVLHVT-GNPLIIGEDVTVGHKVMLHG---------CTIGNRVLVGMGSIVGAIIEDDVMIGAGSLVPQHLESGYLYLGSPVKRPLSDAERSGLQYSANNYVKWKDDYLSQDNHIQ............. 186
39 -16.5003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  17  149...................................................................................................................................................................LQSRSSSIFQTDIHPAARLGSGLFLDHATGLV--------VGETAVVEDNVSILHGVTLGGTGKSSGDRHPKIRQGVLIGAGAKINIQVGQCSKIAAGSVVLKSVPHNVTVAGVPAR.............................................. 259
40 -16.4003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  17  135...................................................................................................................................................................LQNQVSVAFGVDIHPAATIGCGIMLDHATGIV--------IGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKINIEVGRGAKIGAGSVVLQSVPAHTTAAGVPAR.............................................. 245
41 -16.3001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  14  142...................................................................................................................................................................LQNQVSVTFQVDIHPAAKIGRGIMLDHATGIV--------VGETAVIENDVSILQSVTLGGTGKSGGDRHPKIREGVMIGAGAKINIEVGRGAKIGAGSVVLQPVPPHTTAAGVPAR.............................................. 252
42 -15.9001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  19  319.............................................................................................................................................................VADGVIVGPYAHIRPNSSLGAQVHI--GNFVEVGSSIGENTKAGHLTYIGCEVGSNVNFGAGTITVN-YDGKNKYKTVIGNNVFVGSNSTI-VELGDNSLVGAGSTITKDVPADAIAIGRGRQINKDE......................................... 447
43 -15.8001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  19  322.............................................................................................................................................................VADGVTVGPYAHIRPNSSLGAQVHI--GNFVEVGSSIGENTKAGHLTYIGCEVGSNVNFGAGTITVN-YDGKNKYKTVIGDNVFVGSNSTI-VELGDNSLVGAGSTITKDVPADAIAIGRGRQINKDE......................................... 450
44 -15.6003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  12  36.............................................................................................................................................................IAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIR-RTNIQDGVVIHGLQQGRVWIGDNVSITHMALIHG--------PAYIGDGCFIGFRSTVNARVGAGCVVMMHVLIQKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQ-CAENIACIAPIRNELQ 223
45 -15.5003fww_A mol:protein length:456 Bifunctional protein glmU  ali model follow..  21  308.................................................................................................................................................EISPYTVLEDARLDANCTVGPFARLRPGAELAEGAHVGN--FVEIKARLGKGSKAGHLSYLGAEIGAGVNIGAGTITCN-YDGANKFKTIIGDDVFVGSDTQL-VTVANGATIGAGTTVTRDVAENELVISRVKQVHIQG......................................... 448
46 -15.4001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  21  308.................................................................................................................................................EISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGN--FVEMKARLGKGSKAGHLTYLGAEIGDNVNIGAGTITCN-YDGANKFKTIIGDDVFVGSDTQL-VTVGKGATIAAGTTVTRNVGENALAISRVPQTQKEG......................................... 448
47 -15.4002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  21  308.................................................................................................................................................EIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHVGN--FVEIKSTVGKGSKVNHLTYVGSEIGSNCNIGAGVITCN-YDGANKFKTIIGDDVFVGSDTQL-VKVANGATIGAGTTITRDVGENELVITRVAQRHIQG......................................... 448
48 -15.3003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  14  181...................................................................................................................................................................ITEMAHSETGIDIHPGAQIGHHFTIDHGTGVV--------IGATSIIGNNVKLYQGVTLGAKIKGIPRHP-ILEDDVIVYSNATIRVTIGKGATVGGNIWVTENVPAGSRIVQRKNK.............................................. 300
49 -15.0003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  16  330..........................................................................................................................................................SSSIGDGAAVGPFTYLRPGTALGADGKL--GAFVEVNSTIGTGTKVPHLTYVGADIGEYSNIGASSVFVN-YDGTSKRRTTVGSHVRTGSDTMF-VTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIEN......................................... 461
50 -14.7003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  11  156...................................................................................................................................................................MMESVHSYTSIDIHPGASIKGHFFIDHGVGVV--------IGETAIIGEWCRIYQSVTLGAMKRGTKRHP-TVGDYVTIGTGAKVNIIVGSHVRIGANCWIDRDVDSNQTVYISEHPTHFVKPCT...................................... 282
51 -14.6001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  15  61........................................................................................................................................................................VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVL--VEVDGKEYAVYIGNNVSLAHQSQVPAAVGDDTFIGMQAFVFKSLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHL... 239
52 -14.5003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  18  1.............................................................................................................................................................SNAMKKIHPSAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARIDTTIGDHSRVFSYAIVGDIYKEEQKSGVVIGKDCLLGNNIILAVKVGEGCMIAGASALSQDIVPFCLAEGNRASDRLSRAFKTLFRQGDLKENAKNLLENQESENVKKMCH-LETKRGI. 257
53 -14.3003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  17  1.................................................................................................................................................................MKIHPTAIIDPKAELHESVEVGPYSIIEGNVSIQEGTIIEGHVKIGSEIGKFNRFHQGAVIGVMFNQQLLTKTVIGDDCILGNNNILTCFVGDYSMVAGLAKVVQDVPPYSTVDGNPST--VVGLNSVGMKRAGFSPEVRNAIKHAYKVIYHSGISTRKALDELE 232
54 -14.1003eh0_A mol:protein length:341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  17  112.............................................................................................................................................................LGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLNVTIYHEIQIGQNCLIQSGTVVGA-VKIPQIGRVIIGDRVEIGACTTINVVIGDNTAVAGGVIMAGSLKI........................................................ 261
55 -14.0002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  12  133.............................................................................................................................................................IEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIRVVIRERVSIGKRVIIQPGAVIGS-KHLKHLGKVIIEDDVEIGANTTIQVEVGQHSMIVAQAGIAGSTKIGIIGGQAGITGHICIADHVIM---------------MAQTGVTKSITSPGIYGGA. 326
56 -13.6003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  15  128.............................................................................................................................................................VDPSASVGAYAVIESGARIGAGVSIGAHCVIGARSVIGEGGWLRVTLYHDVTIGARVSIQSGAVIGG-QKIAQIGGVTIGDDVEIGANTTINVQIGDHTAMAACVGISGSAKI........................................................ 277
57 -13.2001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  12  2.................................................................................................................................................................SKIAKTAIISPKAEINKGVEIGEFCVIGDGVKLDEGVKLHVHVAHDCVIGSHCILANGVTLAG---------IEIGDYVNIGGLTAI-VRIAKGCMIAGKSALGKDVPPYCTVEGNRAF--IRGLNRHRMRQLLESKDIDFIYALRPIPSLRESAKLLESSRGV. 255
58 -12.9002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  11  88...............................................................................................................................................................................IGDRNRIRESVTIHRGTVQGGGLMINAHIAHDCTVGNRCILANNATLAG---------VSVDDFAIIGGMTAV-CIIGAHVMVGGCSGVAQDVPPYVIAQGNHAT--PFGVNIEGLKRRGFSREAITAIRNAYKLIYRSGKTLDEVKPEIA 239
59 -10.9002f9c_A mol:protein length:334 Hypothetical protein YDCK  ali model follow..  16  198.............................................................................................................................................................KDNNVWICDCAKVYGHARVIAGTEEDAIPTLRYSSQVAEHALINCVLKHHVLVGGHAEVRGGPILLDDRVLIEGHAILIERQVEISGRAAVIAFDDNTIHLRGPKVINGEDRIT....................................................... 318

FFAS is supported by the NIH grant R01-GM087218-01
5 7 0 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.