current user: public




Query: 3dyj_A mol:protein length:332 TALIN-1, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
# Score Template Links and tools%idFirst GIDPFTGIDPFTGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKGTLast
1 -87.2003dyj_A mol:protein length:332 TALIN-1  ali model  100  1GIDPFTGIDPFTGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKGT 332
2 -42.7003fyq_A mol:protein length:199 CG6831-PA (Talin)  ali model follow..  66  2..........SRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRALE.................................................................................................................................... 191
3 -35.4002l7n_A mol:protein length:168 Talin-1  ali model follow..  25  1......GIDPFTGPLEMDSALSVVQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENAGIAARDVAGGLRSLAQAARGVAAL--TSDPAVQAIVLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCLP................................................................................................................................................................ 165
4 -34.3002x0c_A mol:protein length:309 TALIN-1  ali model follow..  16  5........FTKHGQKECDNALRQLETVRELLENPVQPIND--------MSYFGCLDSVMENSKVLGEAMTGISQNANGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTE------------------------------------------------------ENRAQCRAATAPLLEAVDNLSAFASVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPDPPRWSVLAGHSRTVSDSIKKLITSMRDKA.. 305
5 -34.2002kbb_A mol:protein length:174 Talin-1  ali model follow..  17  4.......PFTAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTL--SHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAATQEALEEAVQMMTEAVEDLTTTLNEAASAA.......................................................................................................................................................... 173
6 -32.4004f7g_B mol:protein length:216 Talin-1  ali model follow..  17  16........SKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTL--SHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAATQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQL......................................................................................................................................... 201
7 -32.3002l10_A mol:protein length:158 Talin-1  ali model follow..  17  3.........DPFTQRDVDNALRAVGDASKRLLSDLLPPST--------GTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQ--APSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQA............................................................................................................................................................. 158
8 -30.5002kvp_A mol:protein length:165 Talin-1  ali model follow..  19  1............GIDPFTNEAASAAGVVGGMVDSITQAINEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVA--AENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQA............................................................................................................................................................... 162
9 -28.7001sj8_A mol:protein length:308 Talin 1  ali model follow..  16  19..............NSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAEVGCAVTTISSNLTEMSRGVKLLAALLED-EGGNGRPLLQAAKGLAGAVSELLRSAQPAS-----AEPRQNLLQAAGNVGQASGELLQQIGESDTDPH--------------------------------DVLMQLANAVASAAAALVLKAKSGLQTQVIAAATQCALSTSQLVACTKVVAPTISS-PVCQEQLVEAGRLVAKAVEGCVSASQAATED--GQLLRGVGAAATAVTQALNELLQHVKAHA.. 308
10 -28.5002b0h_A mol:protein length:137 Talin-1  ali model follow..  20  1.....................................GIDPFTMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVA--AENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQA............................................................................................................................................................... 134
11 -27.7001ls4_A mol:protein length:180 Apolipophorin-III  ali model follow..  7..VLMLAVPDAAGHVNIAEAVQQLNHTIVNAAHELHETLGLPTP-------DEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNAFARNLNNSIHDAAT--SLNLQDQLNSLQSALTNVGHQWQDIATKTQASAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQKPAN........................................................................................................................................................ 180
12 -25.5002lqg_A mol:protein length:138 Talin-1  ali model follow..  21  9.......................................................QRLEHAAKQAAASATQTIAAAQHAQPLLVQSCKAVAEQIPLLVQGVRGSQA--QPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQE............................................................................................................................................................ 137
13 -23.1004ons_A mol:protein length:248 Catenin alpha-2  ali model follow..  15  6.......................................................LTVERLLEPLVTQVTTLVGKKKGRSKKAHVLAASVEQATQNFLEKGEQIA----KESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMAD------VMRLLSHLKIVEEALEAVKN--------------------------------ATNEQDLANRFKEFGKEMVKLNYVAARRQQELKD-PHCRDEMAAARGALKKNATMLYTASQAFLRHPVAATRANRDYVFKQVQEAIAGISSAAQATSPT 248
14 -21.8002l7a_A mol:protein length:131 Talin-1  ali model follow..  17  15......................................................AGRYDQATDTILTVTENIFSS-MGDAGEMVRQARILAQATSDLVNAIKADAE--GESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNA................................................................................................................................................................. 128
15 -21.7002jsw_A mol:protein length:189 Talin-1  ali model follow..  17  12.............................................................................................................................................................................AENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRE-LISAARMVAAATNNLCEAANAAVQGHAS----QEKLISSAKQVAASTAQLLVACK-VKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAF 187
16 -21.3001u89_A mol:protein length:139 Talin 1  ali model follow..  11  15...................................................................................................................................................................................................................RGVGAAATAVTQALNELLQHVKAHATG---GPAGRYDQATDTILTVTENIFSSMGD----AGEMVRQARILAQATSDLVNAIKADAEGSDLENSRKLLSAAKILADATAKMVEAAKGAAAH 130
17 -20.7001st6_A mol:protein length:1069 Vinculin  ali model follow..  15  662..............EGIQATVKSARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKSMQPQMLVAGATSIARRANRILLVAKREVE--NSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQQKAGEAINQPMMMAARQLHDEARKWSSKG--------NDIIAAAKRMALLMAEMLVRGGSGNKRALIQCAKDIAKASDEVTRLAKEVAKQCTD-KRIRTNLLQVCERIPTISTQLLSTVKATMDEESEQATEMLVHNAQNLMQSVKETVREAEAAS.. 1048
18 -20.4004p9t_A mol:protein length:263 Catenin alpha-2  ali model follow..  14  2...............PMTSATSPIILKWDPKSLEIRT------------------LTVERLLEPLVTQVTTLVGKKKGRSKKAHVLAASVEQATQNFLEKGEQIA----KESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMAD------VMRLLSHLKIVEEALEAVKN--------------------------------ATNEQDLANRFKEFGKEMVKLNYVAARRQQELKD-PHCRDEMAAARGALKKNATMLYTASQAFLRHPVAATRANRDYVFKQVQEAIAGISSAAQA.... 262
19 -20.0001r0d_A mol:protein length:206 Huntingtin Interacting Protein 12  ali model follow..  12  18.............................................................................................................................................................................VDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKE-LISASKAVGWGATQLVEAADKVVLHTGK----YEELIVCSHEIAASTAQLVAASK-VKANKHSPHLSRLQECSRTVNERAANVVASTKS.... 190
20 -19.9001tr2_A mol:protein length:1066 VINCULIN ISOFORM 1  ali model follow..  15  659..............EGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKNIQPQMLVAGATSIARRANRILLVAKREVE--NSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDGEVINQPMMMAARQLHDEARKWSSKG--------NDIIAAAKRMALLMAEMSVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDK-RIRTNLLQVCERIPTISTQLLSTVKATMDEESEQATEMLVHNAQNLMQSVKETVREAEAAS.. 1045
21 -19.4004igg_A mol:protein length:832 Catenin alpha-1  ali model follow..  13  356...ACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITS-QEKDVDGLDRTAGAIRGRAARVIHVVTSEMDN--YEPGVYTEKVLEATKLLSNTVMPRFTAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPPQEQKAKIAEQVASFQEEKSKLDAEVSK--DDSGNDIIVLAKQMCMIMMEMTDFTRGKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPD-SACKQDLLAYLQRIALYCHQLNICSKVKAEVQNVDSAMSLIQAAKNLMNAVVQTVKASYVAS.. 759
22 -18.3002ch7_A mol:protein length:309 METHYL-ACCEPTING CHEMOTAXIS PROTEIN  ali model follow..  11  2...............................................................SHMKDVQTETFSVAESIEEISKANEEITNQLLGISKEMDNISTRIESISASVQE-TTAGSEEISSATKNIADSAQQAASFADQS---TQLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTNLLALNAAIEAARAGEAGRGFAVVADEIRKAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAVERINEQNIAAAIEEQTAAVDEITTAMTENAKNAEEITNS 269
23 -18.2004e17_A mol:protein length:263 Vinculin  ali model follow..  16  11.......................................................RTIESILEPVAQQISHLVIMHEEGEPDLTAPVSAVQAAVSNLVRVGKETVQ--TTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAE------VRKIIRVCKGILEYLTVAEVVE------TMEDLVTYTKNLGPGMTKMAKMIDERQQE----------------------------THQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKEKMSAEINEIIRVLQLTSWD 258
24 -17.4001u6h_A mol:protein length:280 Vinculin  ali model follow..  15  22.......................................................RTIESILEPVAQQISHLVEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQ--TTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAE------VRKIIRVCKGILEYLTVAEVVET------MEDLVTYTKNLGPGMTKMAKMIDERQQE----------------------------THQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNEEALKNRNFTVEKMSAEINEIIRVLQLTSWD 269
25 -16.9004k1n_A mol:protein length:912 Catenin alpha-1  ali model follow..  14  443...ACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDKDVDGLDRTAGAIRGRAARVIHVVTSEMDN--YEPGVYTEKVLEATKLLSNTVMPRFTAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTKIAEQVASFQEEKSKLDAEVSKWDDSG--------NDIIVLAKQMCMIMMEMTDKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDS-ACKQDLLAYLQRIALYCHQLCSKVKAEVQNSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS.. 846
26 -15.0002gww_A mol:protein length:266 vinculin  ali model follow..  16  9.......................................................RTIESILEPVAQQISHLVEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQ--TTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAE------VRKIIRVCKGILEYLTVAEVVET------MEDLVTYTKNLGPGMTKMAKMIDERQQEMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDA.......................... 259
27 -14.8003vf0_A mol:protein length:283 Vinculin  ali model follow..  12  109.......................................................QPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRG--------GSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLK-------------------ILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIK.............................................................................................. 264
28 -14.6003zx6_A mol:protein length:341 HAMP, METHYL-ACCEPTING CHEMOTAXIS PROTEIN I  ali model follow..  15  1....................MSTITRPIIELSNTVDKIAEGNLEAEVPHQ-ADEIGILAKSIERLRRSLMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASL---------------EETAASMEQLTATVKQNAEN----------ARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRDQVGLAVAEMDRVTQQNAALVEESAAAAAALE.. 289
29 -14.5003s84_A mol:protein length:273 Apolipoprotein A-IV  ali model follow..  12  4...........................................................ELHERLAKDSEKLKEEIGKELEELRARLLPHANEVQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRE-NADSLQASLRPHADELKAKIDQNVEELKGLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFF......... 273
30 -12.9003jbi_V mol:protein length:254 Vinculin  ali model follow..  13  18..................................................................................................................INQPMMMAARQLHDEARKWSSKPVTVINEAAEAGVDIDEEDDADVEFSLPSDIEDDYEPELLLMPTNQPVNQPILAAAQSLHREATKWSSKG-----NDIIAAAKRMALLMAEMLVRGGSGNKRALIQCAKDIAKASDEVTRLAKEVAKQCTD-KRIRTNLLQVCERIPTISTQLLSTVKATMDEESEQATEMLVHNAQNLMQSVKETVREAEAAS.. 238
31 -12.3002jx0_A mol:protein length:135 ARF GTPase-activating protein GIT1  ali model follow..  13  17...................................................................................................................................................................................................................EDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPAL--------EPVRSSLRLLNASAYRLQSECRKTVPPEPGAPTQQVIQCAYDIAKAAKQLVTITTREKKQ 135
32 -12.2003g67_A mol:protein length:213 Methyl-accepting chemotaxis protein  ali model follow..  1.....................................................................................................................RIEEVKERFVNLNRLFQELVGDFQAKSDQVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEAIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVA------NEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETA.. 213
33 -12.1005cwb_A mol:protein length:211 Designed helical repeat protein  ali model follow..  2.............................................................................SYEDECEEKARRVAEKVERLKRSGTSEDEIAEEVAREISE-VIRTLKESGSSYEVICECVARIVAEIVEA--LKRSGTSEDEIAEIVARVISEVIRTLKESGSSYEVICECVARIVAEIVEALKRSGT----SEDEIAEIVARVISEVIRTL--------KESGSSYEVIKECVQRIVEEIVEALKRSGTSEDEINEIVRRVKSEVERTLKESGSS....................................... 202
34 -11.9004wjg_E mol:protein length:343 Haptoglobin-hemoglobin receptor  ali model follow..  2..EGLKTKDEVEKACHLAQQLKEVSITLGVIYRTT----------ERHSVQVEAHKTAIDKHADAVSRAVEALTRVDVALQRLKELGKANDTKAVKIIENITSARENLALFNNETQ-AVLTARDHVHKHRAAALQGWSDAKEKGDAAAEDVWVLLNAAKKGNGSADVKAAAEKCSRYSSTSETELQKAIDAAANVGGL-KYGDVLNKFKLSNASVGAVRDTSGRGGKHVAKLLKDAEVSLAAAAAEIEEVKNAHETKAQEEMKRNGNPIENESETNSGGNAESQGNGDREDKNDEQQQ---DEEETKVENGSSEEGSCCGNESNGPHVMK.. 328
35 -11.8002l7b_A mol:protein length:307 Apolipoprotein E  ali model follow..  10  10.........................................PEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCG---VQYRGEVQAMLGQSTEELRVRLASHLRKLRK------RLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQAEVRAKLEEQAQQIRLQAEAAQARLKSRFEPLAEDMQRQWAGQVEKVQAAEGTSAAPVPS.... 296
36 -11.4004k1p_A mol:protein length:360 NheA  ali model follow..  13........QNVIAPNTLSNSIRMLGSQSPLIQAYGLVILQQNHQKFAKANVREWIDEYNPKLIDLNQEMMRYSIRFNSYYSKLYELAGNINEDEQSK-ADFTNAYGKLQLQVQSIQENMEQDLLELNRFKTVLDKDSNNLSIKADEIKTLQGSSGDIVKLREDIKRIQGEIQAELTTILNRPQEIIKGSINIGKQVFTITNQTAQTKTIDFVSIGTLSNEIVNAADSQTREAALQKQKELLPLIQKLSQTITFVEDQVSSFTELIDRQITTLETLLTDWKVLNNNMIQIQKNVEEGTYTDSSLLQKHFNQIKDEMNKQTNQFEDYVTNVE.. 358
37 -11.2002bsg_A mol:protein length:487 FIBRITIN  ali model follow..  23.ISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKN-------GILKTSLETANSDIKTIQGILDVSIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQDINGLPVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGYPGNNSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSI-DIPSSIKGQIKDNTTSIESLNGIVGENTSSGLRANVSWLNQIVGT........... 348
38 -10.9003ay5_A mol:protein length:360 Cyclin-D1-binding protein 1  ali model follow..  3.....SATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEENREMFWRRLNEAAVTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDGITLRKLVRGATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVE--ESDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRASKACLKKIRMLVKDQVAQLDDIVDISDEISPSVDDLALSI-------PPMSHLTVRINSAKLVSVLKKALEITKASHVT 328
39 -10.8002a01_A mol:protein length:243 Apolipoprotein A-I  ali model follow..  10  2............................................................................EPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSAKQLNLKLLDNWDSVTSTFSKLREQLGPVT-----QEFWDNLEKETEGLRQEMSKDLEEVKAVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGG--ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNT........... 242
40 -10.4002nrj_A mol:protein length:346 Hbl B protein  ali model follow..  10  64..............................................................GRIVQDQKNARAHAVTWDTKVKKQLLDTLNGIVEYDTTFDNYYETMVE-NTGDGETLKEGITDLRGEIQQNQKYAQQLIEELTK---RDSIGHDVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESDGFNVMKGAILGLPIIGGIIVGVARDNL-LEPLLAELRQTVDYKVTLNRVVGVAYSNINEMHKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKADQNKFKFLKPNLNAAKDSWKTLRTDAVTLKEG 333
41 -10.1003o1h_A mol:protein length:277 Sensor protein TorS  ali model follow..  10  1............GSGSAMIEARQVSELSTRIISSVQMLSN----AQNEQERKEAGRVLFEQLESLLTHIKELGGESFDSKDALESNVQNVINNLAELGVTVER----------WLAKEIDTRVEEMRLLSEELEQLTRTQVQNTSTIAVANVTHIYDLLEANKKDQVYQALDALVEVDLDLTERLHELHLLAFKMLNQIEEARTLTNVDRIQQIQTAFENNLKIMKRRVLAVEDPTRSKQMSQLLTELGKRQVVFTILLQQYENNEQSQQLMQKTLELFSELNSTVNKLVDDSNKTTTK................................. 277
42 -9.8302yfa_A mol:protein length:258 METHYL-ACCEPTING CHEMOTAXIS TRANSDUCER  ali model follow..  1..................................................................................MGSSSSGLVPRGSHMGDIGQLNKDLTDLR-ANGDDTAAANTLAKLDAFSKQQAYLATTFKSPENVKLLGELGDTISAYKLSLNKMRQGYDATRAARVSMDSSAIRADQAMDALSQEVMARP--EADSVRLAQYQLISKARQQLLQVRIDVRGYIAENSSANEQAALRQLDAALADTDNLKRQLPSEDARLQQFENAVLAYRDAVRQFRDAVANI-----TTSRAEMTVQGADIVKRSDALYQIQLERRDI 250
43 -9.6901eq1_A mol:protein length:166 APOLIPOPHORIN-III  ali model follow..  10  1........DAPAGGNAFEEMEKHAKEFQKTFSEQFNSLVNSKNTQDFNKALKDGSDSV---LQQLSAFSSSLQGAISDANGKAKEALEQARQNVEKTAEELRKAHPDVEKEANAFKDKLQAAVQTTVQESQKLAKEVASNMEETNKK-LAPKIKQAYDDFVKHAEEVQKKLHEAATK........................................................................................................................................................... 165
44 -9.6904k1o_A mol:protein length:264 Catenin alpha-2  ali model follow..  13  36...................................................QEEKAKIAEQVEIFHQEKSKLDAEVDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPL------KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQL-------------------NICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYV.................................................................................................. 196
45 -9.6404hpq_C mol:protein length:413 Atg17  ali model follow..  96.............QNEITKMMNKLDNITNEIDQQHNSKLGDFISRDSSHILDSKLNEIPTIRKQVENITRQYQTMLAKVQSQLVESRDEFSSKFGDQCRENLKLNEEFTNEADQLEQELADFLKSFTDHFDKCSALSSRSVSPEDAQNLFEIVERDDKDLAAINSLLQDAAIDVASFVRKVNMLLDERDADKAKMQATLSK------------------------------------LTELRKHEEYISVFEGISALIQKFKASCLEDIRQTRNLLDFYANFERSYHNLLKEVKR-----RKETAAKLSQILKSCETQLEQINTADLRER.. 377
46 -9.5801qoy_A mol:protein length:318 HEMOLYSIN E  ali model follow..  12  1GSPGISG--GGGG-EVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDIL--IKVLDDGITKL-------------NEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYA----------GAAAGVVVGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGEIKTETET-----TRFYVDYDDLMLSLLKEAAKKMINTCNEYQK........ 305
47 -9.2604e40_A mol:protein length:252 Putative uncharacterized protein  ali model follow..  10  1.....................................................................AEGEIKVELEDSDDVAAACELRAQLAGVSGILLRPAVIRNATTEFSRKKSEDILAKGGAAVERASAAVDRVSGLDKTNETAQKVRKAAAVAHHALEHVKEEVEIVAKKVNEIIELTAGATEHAKGAKANGDASAVK-----VSNLLARAKESENQYVKEAAEECS-ESTNYDVTAKSLAAALDKLVKEDNAVKTTFQSILTSLDNLDKDVKSVEQRAEEL------------ETALEKAERQLEKAEKAAEEAETESSKVE.. 248
48 -9.0502tma_A mol:protein length:284 TROPOMYOSIN  ali model follow..  14  1....................MDAIKKKMQMLKLDKENALDRAEQAEADKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEAL-KDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAAD---ESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEE-----RAELSEGKCAELEEEIKTV-----TNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQ-----KLKYKAISEELDHALNDMTSI.......... 284

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.