current user: public




3dyjA
Query: 3dyj_A mol:protein length:332 TALIN-1, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
# Score Template Links and tools%idFirst GIDPFTGIDPFTGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKGTLast
1 -79.8003dyj_A mol:protein length:332 TALIN-1  ali model  100  1GIDPFTGIDPFTGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKGT 332
2 -42.1003fyq_A mol:protein length:199 CG6831-PA (Talin)  ali model follow..  66  2..........SRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRALE.................................................................................................................................... 191
3 -31.3002kbb_A mol:protein length:174 Talin-1  ali model follow..  19  1GID----PFTAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKT--LSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAHTQEALEEAVQMMTEAVEDLTTTLNEAASAA.......................................................................................................................................................... 173
4 -30.8002x0c_A mol:protein length:309 TALIN-1  ali model follow..  13  1GID----PFTKHGQKECDNALRQLETVRELLENPVQPINDMSYF--------GCLDSVMENSKVLGEAMTGISQNAKNGLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQQQGLVEPTQFARANQAIQMACQSLG---EPGCTQAQVLSAATIVAKHTSALCNSCRLASARTA--------------------NPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPG 307
5 -28.4002l10_A mol:protein length:158 Talin-1  ali model follow..  19  1GID-------PFTQRDVDNALRAVGDASKRLLSDLLPPSTGT--------FQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQ--APSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQA............................................................................................................................................................. 158
6 -28.1001ls4_A mol:protein length:180 Apolipophorin-III  ali model follow..  18........PDAAGHVNIAEAVQQLNHTIVNAAHELHETLGLPTP-------DEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNAFARNLNNSIHDAATS--LNLQDQLNSLQSALTNVGHQWQDIATKTQASAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQKPAN........................................................................................................................................................ 180
7 -28.1002l7n_A mol:protein length:168 Talin-1  ali model follow..  25  1GID------PFTGPLEMDSALSVVQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEIAQNENYAGIAARDVAGGLRSLAQAARGVAA--LTSDPAVQAIVLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCL................................................................................................................................................................. 164
8 -25.5002kvp_A mol:protein length:165 Talin-1  ali model follow..  19  1............GIDPFTNEAASAAGVVGGMVDSITQAINEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVA--AENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNR............................................................................................................................................................ 165
9 -25.3001sj8_A mol:protein length:308 Talin 1  ali model follow..  14  1...................................................RGHMPPLTSAQQALTGTINSSMQAVQARKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDTAVGCAVTTISSNLTEMSRGVKLLAALEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPR---QNLLQAAGNVGQASGELLQQIGDTDPHFQDVLMQLANAVASAAAALVLKAKSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSP-VCQEQLVEAGRLVAKAVEGCVSASQAATE--DGQLLRGVGAAATAVTQALNELLQHVKAHA.. 308
10 -24.3002b0h_A mol:protein length:137 Talin-1  ali model follow..  18  1.....................................GIDPFTMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAA--ENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNR............................................................................................................................................................ 137
11 -22.6002ch7_A mol:protein length:309 METHYL-ACCEPTING CHEMOTAXIS PROTEIN  ali model follow..  10  1.......................................................GSHMKDVQTETFSVAESIEEISKANEEITNQLLGISKEMDNISTRIESISASV-QETTAGSEEISSATKNIADSAQQAASFADQST----------QLAKEAGDALKKVIEVTRMISNSAKDVERVVESFQKGAEEITSFVETINAIAEQTNLLALNAAIEAARA-AGRGFAVVADEIRKLAEESQQASENVRRVVNEIRSIAEDAGKVSSEITARVEEGTKLADEADEKLNSIVGAVERINEQNIAAAIEEQTAAVDEITTAMTENAKNAEEITNS 269
12 -20.1001dow_A mol:protein length:205 ALPHA-CATENIN  ali model follow..  14  2......................................................................................AHVLAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMAD------VYKLLVQLKVVEDGILKLRNAGN--------------------------------EQDLGIQYKALKPEVDKLNIMAAKRQQELKD-VGNRDQMAAARGILQKNVPILYTASQACLQHPVAAYKANRDLIYKQLQQAVTGISNAAQ..... 204
13 -19.3001u6h_A mol:protein length:280 Vinculin  ali model follow..  15  22.......................................................RTIESILEPVAQQISHLVEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQT--TEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAE------VRKIIRVCKGILEYLTVAEVVETM------EDLVTYTKNLGPGMTKMAKMIDERQQE----------------------------THQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNEEALKNRNFTVEKMSAEINEIIRVLQLTSWD 269
14 -19.1002gww_A mol:protein length:266 vinculin  ali model follow..  14  10........................................................TIESILEPVAQQISHLVEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQT--TEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAE------VRKIIRVCKGILEYLTVAEVVET--------------------------------MEDLVTYTKNLGPGMTKMAKMIDERQQELTH-QEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKALKNRNFTVEKMSAEINEIIRVLQ..... 251
15 -18.6001h6g_A mol:protein length:256 ALPHA-1 CATENIN  ali model follow..  13  1.............................DLRRQLRKAV---------------MDHVSDSFLETNVPLLVLIEAANGNEKEVKEYAQVFREHANKLIEVANLACSI--SNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVTEKVLEATKLLSNTVMPRFTEQVEAAVEA------------------------------SSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMI... 256
16 -18.5003g67_A mol:protein length:213 Methyl-accepting chemotaxis protein  ali model follow..  2........................................................................................................IEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDME----------KISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEV-----RNSLDTSKESLSEKSAEIDSATKVLEETA.. 213
17 -18.0003zx6_A mol:protein length:341 HAMP, METHYL-ACCEPTING CHEMOTAXIS PROTEIN I  ali model follow..  14  1....................MSTITRPIIELSNTVDKIAEGNLEAEVPHQ-ADEIGILAKSIERLRRSLMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASL---------------EETAASMEQLTATVKQNAEN----------ARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRDQVGLAVAEMDRVTQQNAALVEESAAAAAALE.. 289
18 -17.5001r0d_A mol:protein length:206 Huntingtin Interacting Protein 12  ali model follow..  12  18.............................................................................................................................................................................VDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSLQKE-LISASKAVGWGATQLVEAADKVVLHTGK----YEELIVCSHEIAASTAQLVAASK-VKANKHSPHLSRLQECSRTVNERAANVVASTKSGQ.. 192
19 -17.5002l7a_A mol:protein length:131 Talin-1  ali model follow..  16  16.......................................................GRYDQATDTILTVTENIFSS-MGDAGEMVRQARILAQATSDLVNAIKADAEG--ESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNA................................................................................................................................................................. 128
20 -17.2001u89_A mol:protein length:139 Talin 1  ali model follow..  11  15...................................................................................................................................................................................................................RGVGAAATAVTQALNELLQHVKA--HATGAGPAGRYDQATDTILTVTENIFSSMGD-----GEMVRQARILAQATSDLVNAIKADAEGSDLENSRKLLSAAKILADATAKMVEAAKGAAAH 130
21 -17.2002jsw_A mol:protein length:189 Talin-1  ali model follow..  18  12.............................................................................................................................................................................AENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRE-LISAARMVAAATNNLCEAANAAVQGHAS----QEKLISSAKQVAASTAQLLVACK-VKADQDSEAMKRLQAAGNAVKRASDNLVKAAQK.... 183
22 -15.7001st6_A mol:protein length:1069 Vinculin  ali model follow..  15  662..............EGIQATVKSARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKNMQPQMLVAGATSIARRANRILLVAKREVEN--SEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEKAGEAINQPMMMAARQLHDEARKWSSKG--------NDIIAAAKRMALLMAEMSVRGGSGNKRALIQCAKDIAKASDEVTRLAKEVAKQCTD-KRIRTNLLQVCERIPTISTQLLSTVKATMDEESEQATEMLVHNAQNLMQSVKETVREAEAAS.. 1048
23 -14.9001l7c_A mol:protein length:269 Alpha E-catenin  ali model follow..  11  5......................................................MDHVSDSFLETNVPLLVLIEAAKNNEKEVKEYAQVFREHANKLIEVANLACSI--SNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAV------LMIRTPEELDDSDFETED............... 265
24 -14.1001tr2_A mol:protein length:1066 VINCULIN ISOFORM 1  ali model follow..  15  659..............EGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAID--NIQPQMLVAGATSIARRANRILLVAKREVEN--SEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQP-QKAGEVINQPMMMAARQLHDEARKWSSKG--------NDIIAAAKRMALLMAEMSVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTD-KRIRTNLLQVCERIPTISTQLLSTVKATMDEESEQATEMLVHNAQNLMQSVKETVREAEAAS.. 1045
25 -14.0003myi_A mol:protein length:172 Vinculin  ali model follow..  17  6......................................................................................................................................................................................QPILAAAQSLHREATKWSSKG--------NDIIAAAKRMALLMAEMSVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTD-KRIRTNLLQVCERIPTISTQLKILSTVKATEESEQATEMLVHNAQNLMQSVKETVREAEAAS.. 155
26 -11.4003lnr_A mol:protein length:175 Aerotaxis transducer Aer2  ali model follow..  10  9...................AHAVAQQRADRIATLLQSFADGQLDTAVGEAPAPGYERLYDSLRALQRQLREQRAELQQVESLEAGLAEMSRQHEA----DQTIPAERLEGRAARIAKGVNELVAAHIAVKMKVVSVVTAYGQ--NFEPLMDRLPGKKAQITEAIDGVRERLRGAAEATSAQLATAA.................................................................................................................................................. 173
27 -11.1002nrj_A mol:protein length:346 Hbl B protein  ali model follow..  50.........................................NFEGITINGYVDLPGRIVQDQKNARAHAVTWDTKVKKQLLDTLNGIVEYDTTFDNYYETMVEAIETLKEGITDLRGEIQQNQKYAQQLIEELTKLRDSIGHDVRAGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYYKQLESDGFNVMKGAILGLPIIGGIIVGVARDNLGKLEPLLAELRQTV-------------DYKVTLNRVVGVAYSNINEMHKALDDAINALTYMSTQWHDLDSQYSGVLGHIENAAQKADQNKFKFLKPNLNAAKDSWKTLRTDAVTLKEG 333
28 -11.0003zqb_A mol:protein length:305 PROTEIN PRGI, CELL INVASION PROTEIN SIPD  ali model follow..  12................LDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFRGGSGGTDMVSQNISAIGDSYLGVYENVVAVYTDFYQAFSDILSKMGGWLLPGKDGNTVKLDVTSLKNDLNSLVNKYNQINSNTVLFPAQSGSGVKVATEAESELNLPNSCLKSVDLTPLQKMVQDIDGLGAPGKDSKLEMDNAKYQAWQSGFKAQEENMKTTLQTLTQKYSNANSLYDNLVKV---LSSTISSSLETAKSFLQG........................................ 305
29 -10.7003ay5_A mol:protein length:360 Cyclin-D1-binding protein 1  ali model follow..  1...MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGE-ETTEEFNREMFWRRLNEAAVTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITRKLVRGATLDIVDGMAQLMEVLSVTPTQSPENNDLISYRDNKAAALLMLTKNVDFVKDAHEEMEQAVEESDPYSGLLNDTEENNSDNHSEDDQELIIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSI--PPMSHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSPLLINAIDHCMNRIKELTQSELEL... 360
30 -10.7002l7b_A mol:protein length:307 Apolipoprotein E  ali model follow..  16...................................................QQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLS-SQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQA---GADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEVAEVRAKLEEQAQQIRLQAEAAQARLKSRFEPLAEDMQRQWAGQVEKVQAAEGTSAAPVPS.... 296
31 -10.7002a01_A mol:protein length:243 Apolipoprotein A-I  ali model follow..  2.......................................................EPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEG-SALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLR------------QEMSKDLEEVKAKVQPYLDDFQKKWQE------EMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLA------EYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNT........... 242
32 -10.1001qoy_A mol:protein length:318 HEMOLYSIN E  ali model follow..  23....................................................KTVEVVKNAIETADGALDLYNKYLDQVIQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNE-KKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAAAAGVVVGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKLKLTTEIAAIGE-IKTETETTRFYVDYDDLMLSLLKEAAKKMINT.... 299
33 -10.1002bsg_A mol:protein length:487 FIBRITIN  ali model follow..  30........EEILGADTQYGSEGSMNRPTVSVLRNVEVLDKN-------GILKTSLETANSDIKTIQGILDVSIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGYPGNNSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSI-DIPSSIKGQIKDNTTSIESLNGIVGENTSSGLRANVSWLNQIVGTDSSGGQP.... 355
34 -10.0001u4q_A mol:protein length:322 Spectrin alpha chain, brain  ali model follow..  9.............NTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRETINGRFQRIKSMAAARRAKLNESHRQFFRDMDDEESWIKEKKLLVSSYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKELKQLAAAEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSA................ 322
35 -9.9201hci_A mol:protein length:476 ALPHA-ACTININ 2  ali model follow..  141..............STHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERM-APFNNWMEGAMEDLQDM-HSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHA---------NERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDN-KHTNYTMEHIRVGWELLLTTIAR.... 463
36 -9.9001yvl_A mol:protein length:683 Signal transducer and activator of transcript  ali model follow..  5.....................YELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEK--QDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHE----IKSLEDLQDEYDFKCKTLQNREHETNGVA-KSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQ 311
37 -9.8503kbt_A mol:protein length:326 Spectrin beta chain, erythrocyte  ali model follow..  11..............LDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAEERKRKL-----ENMYHLFQLKRETDDLEQWISEKELVASSPEMGQD------------FDHVTLLRDKFRDFARETGAIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDT--SYDLHRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERDVHLLGVQVQQFQDVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAG.... 314
38 -9.5303edv_A mol:protein length:323 Spectrin beta chain, brain 1  ali model follow..  10  10.................................................QLNREVDDLEQWIAEREVVAGS-YEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDI---------------QALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGD-KFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCI.. 279
39 -9.4501ya9_A mol:protein length:181 Apolipoprotein E  ali model follow..  10  11......................................................................................................................................................WQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQS-SQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLG------QSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQ.... 181
40 -9.4303o1h_A mol:protein length:277 Sensor protein TorS  ali model follow..  1.....GSGSAMIEARQVSELSTRIISSVQMLSNA-----------QNEQERKEAGRVLFEQLESLLTHIKELGGESFDSKDALESNVQNVINNLAELGVTVERKLW-LAKEIDTRVEEMRLLSEELEQLTRTQVQNTS-----TIAVANVTHIYDLLEA--NKKDQVYQALDALVEVDLDLTERLHELHLLAFKMLNQIEEARTLTNVDRIQQIQTAFENNLKIMKRRVLAVEDPTRSKQMSQLLTELGKRQVVFTILLQQYENNEQSQQLMQKTLELFSELNSTVNKLVDDSNKTTTK................................. 277
41 -9.3702f95_B mol:protein length:163 Sensory rhodopsin II transducer  ali model follow..  12  81.....................GDTAASLSTLAAKASRMGDGDLDVELETRREDEIGDLYAAFDEMRQSVRTSLEDAKNAREDAEQAQKRAEE................................................................................................................................................................................................................................................ 151
42 -9.2701c1g_A mol:protein length:284 TROPOMYOSIN  ali model follow..  13  1......................................................MDAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDEL-VSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEI-QLKEAKHIAEDADRKYEEVARKLVII--ERAEERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFALEKSIDDLEDELYAQKLKYKAISEELDHALNDMT.. 282
43 -9.1802tma_A mol:protein length:284 TROPOMYOSIN  ali model follow..  10  1....................MDAIKKKMQMLKLDKENALD--------EQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKL-ELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEER-AELSEGKCAELEEEIKTV-----TNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYA-----QKLKYKAISEELDHALNDMTSI.......... 284
44 -9.1602jx0_A mol:protein length:135 ARF GTPase-activating protein GIT1  ali model follow..  14  17...................................................................................................................................................................................................................EDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPAL--------EPVRSSLRLLNASAYRLQSECRKTVPPEPQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ 135

FFAS is supported by the NIH grant R01-GM087218-01
5 9 9 8 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Harder T, Kolodny R, Sitbon E, Li Z, Godzik A. Using an alignment of fragment strings for comparing protein structures. Bioinformatics. 2007 Jan 15;23(2):e219-24.