current user: public




Query: 3dx5_A mol:protein length:286 uncharacterized protein AsbF, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MKYSLCTISFRHQLISFTDIVQFAYENGFEGIELWGTHAQNLYMQEYETTERELNCLKDKTLEITMISDYLDISLSADFEKTIEKCEQLAILANWFKTNKIRTFAGQKGSADFSQQERQEYVNRIRMICELFAQHNMYVLLETHPNTLTDTLPSTLELLGEVDHPNLKINLDFLHIWESGADPVDSFQQLRPWIQHYHFKNISSADYLHVFEPNNVYAAAGNRTGMVPLFEGIVNYDEIIQEVRDTDHFASLEWFGHNAKDILKAEMKVLTNRNLEVVTSENLYFQLast
1 -98.3003dx5_A mol:protein length:286 uncharacterized protein AsbF  ali model  100  1MKYSLCTISFRHQLISFTDIVQFAYENGFEGIELWGTHAQNLYMQEYETTERELNCLKDKTLEITMISDYLDISLSADFEKTIEKCEQLAILANWFKTNKIRTFAGQKGSADFSQQERQEYVNRIRMICELFAQHNMYVLLETHPNTLTDTLPSTLELLGEVDHPNLKINLDFLHIWESGADPVDSFQQLRPWIQHYHFKNISSADYLHVFEPNNVYAAAGNRTGMVPLFEGIVNYDEIIQEVRDTDHFASLEWFGHNAKDILKAEMKVLTNRNLEVVTSENLYFQ 286
2 -57.4003tva_A mol:protein length:290 Xylose isomerase domain protein TIM barrel  ali model follow..  14  11WPIGVFT----SVDAGLGVHLEVAQDLKVPTVQVHAPHPHTR---TREHAQAFRAKCDAAGIQVTVIFGGFDLVPLETRASRVAEMKEISDFASWVGCPAIGLHIGFVPESS--SPDYSELVRVTQDLLTHAANHGQAVHLETGQ----ESADHLLEFIEDVNRPNLGINFDPANMILYGGNPIEALRKVARYVRSIHCKDALWAPVNE---------RGKSWGQEVALGTGDVGMEAYLTTLWGYRGPLTIEREIPHDPKDLASALELLTGLRKKIAN....... 289
3 -53.9003cqh_A mol:protein length:295 L-ribulose-5-phosphate 3-epimerase ulaE  ali model follow..  11  11IPLGIYEKALPAG-ECWLERLQLAKTLGFDFVEMSVDETDERLSRSREQRLALVNAIVETGVRVPSMCLSAH-EDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNV-----------------PFGEGVVDFERCFETLKGYCGPYLIEMTAEDPAAEVAKARDWVKARMAKAGMVEAA... 289
4 -53.6002zds_A mol:protein length:340 Putative DNA-binding protein  ali model follow..  17  3RNFTLFTGQWAD--LPLEEVCRLARDFGYDGLELACWGDHDKALADPSYVDSRHQLLDKYGLKCWAISNHLDGDAEGVRQRAAAEIKDTARAAARLGVDTVIGFTGSAIPESMIERGYQDFADRWNPILDVFDAEGVRFAHEVHPSEIAYDYWTTHRALEAVGRPAFGLNFDPSHFVWQDLDPVGFLWDFRDRIYHVDCKEARKRGRNGRLGSHLPWGDPRRGWDFVSAGHGDVPWEDVFRMLRDYQGPVSVEWEDMDRLQGAPEALTRLKAFDFEPPSAS..... 325
5 -52.1004ovx_A mol:protein length:277 Xylose isomerase domain protein TIM barrel  ali model follow..  16  10FEISLAQWSLHKKKADPMDFAKIKEEFGINAIEYVNQF--KGKAEDQAFLADLKKRADDHGVKSLLIMCDGE-ADEAKRKKAVENHYKWVAAAKYLGCHSIRVNAQ---SGGSYDEQLARAADGLRRLTEFAATHDINVIVENH-GGLSSNGAWLAAVMKKVDHPRCGTLPDFGNFRVSKDDRYKGVEELMPFAKAVSAKSHDFDA---------------------AGNEIHTDYRKMMKIVAGYKGYVGIEYEGSKISEATKKLLETVRSEMA........... 277
6 -52.0001yx1_A mol:protein length:264 hypothetical protein PA2260  ali model follow..  10  6HPVSISLSSYGADLRGQASFLPLLAMAGAQRVELREELFA-----GPPDTEALTAAIQLQGLECVFSSPLELWREDGQLN---PELEPTLRRAEACGAGWLKVSLGLLPEQ-----------PDLAALGRRLARHGLQLLVENDQTPQGGRIEVLERFFRLAERQQLAMTFDIGNWRWQEQAADEAALRLGRYVGYVHCKAVIRNR----------------DGKLVAVPPSAADLQYWQRLLQPEGVARAIEYPGDDLLSLSRRHIAALARLGQPQEERQHG... 262
7 -48.5003wqo_A mol:protein length:293 Uncharacterized protein MJ1311  ali model follow..  18  17MKFGVSSLVFLPE--SLTSSMEKIAEHNFDAWEIVCEGTHYL---SPKNIKYLMELRDRYEVEIVVHAPFSDLNNERVRKLTVECIRDAIEGAFELDSEVVVVHPGYIPESNYVSEILDNNFSTLSEIVEIAEDYGIKIGLENFRGVLGITPESLLEIVKDIDSKNLGITFDIGHANTAGNEFVEKLQNIGIGIIHVHAHD-----------------NNGYDDEHLKIGEGNINFIEVLEKLKGYDGVISIENKNVKSKEILKEYLEIVNEKVAEKEKIE..... 292
8 -48.4004kw2_A mol:protein length:265 Uncharacterized protein  ali model follow..  14  16WKVGIQTWTFHN--LTLMETLDKTQQLGMGYAEAFFFETYLNYDLSDDNCALLRHEFKIRGIKPIAFGV--------ASYGTNEEWDKFFAFAHKIGAHIVTV---------------EPELNQLDYIESLAKKYDMEVAIHNHPSPCIYASAEVVEKALKGRSPLMGVCADIGHWKRVGEDPLKNLQKLSGRIKVAHLKDLT------------------DKMEDATWGTGILPVKAFVNELKHFNGLISIEYDDFKSDQEIRNSLEFLQKCSK........... 259
9 -45.8003kws_A mol:protein length:287 Putative sugar isomerase  ali model follow..  14  26LKLSFQEGIAPGE--SLNEKLDFMEKLGVVGFEPGG-------GGLAGRVNEIKQALNGRNIKVSAICAGFKSTDPAIRKECMDTMKEIIAAAGELGSTGVIIFNGQVPALPHTMETRDFLCEQFNEMGTFAAQHGTSVIFEPKECFYLRQVADAASLCRDINNPGVRCMGDFWHMTWEETSDMGAFISGGEYLQHVHVASRKRRSMPGE-------------------DGDADNYINGFKGLKGYNNYVSFEGCQGDRNVVVPAAVKLLREQWEQA......... 287
10 -45.7003p6l_A mol:protein length:262 Sugar phosphate isomerase/epimerase  ali model follow..  17  10WRLGMQSYSFHL--FPLTEALDKTQELGLKYIEIYPGHKLGGKWGDKQTQKEIKELAASKGIKIVGTGVYVA--------EKSSDWEKMFKFAKAMDLEFITC---------------EPALSDWDLVEKLSKQYNIKISVHNHPQPSDYWKPENLLKAISGRSQSLGSCSDVGHWRREGLNQIDCLKQLKGRIISLHFKDIAPKK------------AGENEQHDVIWGTGILDVKGMLKELKNFKGVFSIEYEYENSVPDIKECIQYFNKTANEIL........ 262
11 -44.7003cny_A mol:protein length:301 Inositol catabolism protein IolE  ali model follow..  16  10IKWGIAPIGWRNDDINLQQLLSDIVVAGFQGTEVGGFFP---------GPEKLNYELKLRNLEIAG-QWFSSYIIRDGIEKASEAFEKHCQYLKAINAPVAVV-NIFKDKPYFTDKEWDEVCKGLNHYGEIAAKYGLKVAYHHHMGTGIQTKEETDRLMANTDPKLVGLLYDTGHIAVSDGDYMALLNAHIDRVVHVHFKDVRRSKEEECRAKGLTFQGSFLNGMFTVPGDGDLDFKPVYDKLINYKGWIVVEAEQDNPLEMAQIAHRYIKQHLIE.......... 300
12 -44.7001i60_A mol:protein length:278 IOLI PROTEIN  ali model follow..  11  1MKLCFNEATTLENS-NLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHS-LDDLAEYFQTHHIKPLALNAFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEFHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVW-----------PGQGAIDLDAHLSALKGFSDVVSVEYYKLTAEEAIQTAKKTTVDVVSKYFS....... 277
13 -43.7002zvr_A mol:protein length:290 Uncharacterized protein TM_0416  ali model follow..  12  15MKLSLVISTSDAAKGDLRKGMELAKRVGYQAVEI------AVRDPSIVDWNEVKILSEELNLPICAIGTSLTHPNDEIRKKAIERVVKHTEVAGMFGALVIIGLVRGRREGRSYEETEELFIESMKRLLELTE--HAKFVIEPYETDFINTIDDALRILRKINSNRVGILADTFHMNIEEVNIPESLKRAGEKLYHFHVAD----------------------SNRWAPGCGHFDFRSVFNTLKGYNRYVSVECLPGGMEEAAEIAFKTLKELIIKLT........ 284
14 -42.6003u0h_A mol:protein length:281 Xylose isomerase domain protein  ali model follow..  11  4MEPCLHPTLVDE--TSLVLYLDLARETGYRYVDVPFHWLEAEA--ERHGDAAVEAMFQRRGLVLANLGLPLNLDSEPVFLRELSLLPDRARLCARLGARSVTAFLW-PSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEHRRYPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAGEHEDDLAQLPPEKVVYVHINDTRDAPEDAHDGKRLL-------------GDGRIPLVPFLRGLYGYRGPVAAEPLDGTGESRARLVRERLEKLIALAKG....... 281
15 -42.5003lmz_A mol:protein length:257 Putative sugar isomerase  ali model follow..  10  18FHLGMAGYTFVN--FDLDTTLKTLERLDIHYLCIKDFHLP--LNSTDEQIRAFHDKCAAHKVTGYAVGP---------YMKSEEEIDRAFDYAKRVGVKLIV----------------VPNYELLPYVDKKVKEYDFHYAIHLHGPDIKTYPDATDVWVHTKDDPRIGMCLDVGHDLRNGCDPVADLKKYHTRVFDMHIKDVT---------------DSSKAGVGIEIGRGKIDFPALIRMMRNYTGMCSLEYEKDDPFLGIAESIGYFKAVSDLT......... 257
16 -42.1003vni_A mol:protein length:294 Xylose isomerase domain protein TIM barrel  ali model follow..  12  2MKHGIYYAYWQEWEADYKYYIEKVAKLGFDILEI---AASPLPFYSDIQINELKACAHGNGITLTVGHG-LSSPDPDIRKNAKAFYTDLLKRLYKLDVHLISYWPIDYTKTIDKKGDWERSVESVREVAKVAEACGVDFCLEVFENYLINTAQEGVDFVKQVDHNNVKVMLDTFHMNIEEDSIGGAIRTAGSYLGHLHTGE----------------------CNRKVPGRGRIPWVEIGEALAGYNGSVVMEPFVRMGGTVAQAALDFSRYVLECHKHS...... 294
17 -41.4002hk0_A mol:protein length:309 D-PSICOSE 3-EPIMERASE  ali model follow..  13  16MKHGIYYSYWHEWSAKFGPYIEKVAKLGFDIIEV----AHHINEYSDAELATIRKSAKDNGIILTAGIGPLSSEDAAVRAAGKAFFERTLSNVAKLDIHTISYWPIDYSQPVDKAGDYARGVEGINGIADFANDLGINLCIEVFENHVLNTAAEGVAFVKDVGKNNVKVMLDTFHMNIEEDSFGDAIRTAGPLLGHFHTGESNRR----------------------VPGKGRMPWHEIGLALRNYTGAVIMEPFVKTGGTIGSDSGGADIAKMDEDARNALAFSR 299
18 -41.0004xsl_A mol:protein length:300 D-tagatose 3-epimerase  ali model follow..  12  3.KVGMFYTYWTEWMVDFPATAKRIAGLGFDLMEISLGEFHNL---SDAKKRELKAVADDLGLTVMCSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVF---QSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGE----------------------ANRLPPGEGRLPWDEIFGALKGYDGTIVMEPFDEEMDERARRSLQFVRDKLAGSRS....... 294
19 -40.7004k3z_A mol:protein length:331 D-erythrulose 4-phosphate dehydrogenase  ali model follow..  10  18LTLSLNTNPLVNRFAEPDDLITVARDLRLRDLQLTHEFINPSWQASRRLTRDMDRALQRTGVRVTSG-NHFGHPDRDVRRYYVDWFKTFADIIGDLGGKSVGTQFAIFTDPARREELIKIAIDCWAEVAEHAAGAGLDYVFWEPGREFGETIAECMKLQDRLTAANMWMMADIDHGDVTSADPYAWARTVPKVSPIIHIKQSLMDKGGH-------------PFTAAFNAKGRIQPEPLLKAFAEVDNEICLELNDREVIPQIAESVAFWAPHIDT.......... 318
20 -40.6004q7i_A mol:protein length:298 D-tagatose 3-epimerase  ali model follow..  13  3.KVGMFYTYWTEWMVDFPATAKRIAGLGFDLMEISLGEFHNL---SDAKKRELKAVADDLGLTVMCCEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAWPQHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEVYEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEENSFRDAILACKGKMGHFHLGE----------------------QNRLPPGEGRLPWDEIFGALKGYDGTIVMEPFMRTGGS-VSRAVCVWRDLSNGATDEE..... 273
21 -39.3003qxb_A mol:protein length:316 Putative Xylose isomerase  ali model follow..  10  14MKLGVNLCFAVKRWLEPDRLALVRDDLGLEYVQY--TDPWWPDIERDRRAIAYAKAFRKAGLTIESTFGHFLAPTLELQSLGYQHLKRAIDMTAAMEVPATGMPFGSYSNPARREEIYAIARDMWIELAAYAKRQGLSLYVEPVPTEFPSSAADAARLMADLDGIPVRLLVDWGHALFEPLDMDHWMDLCQPWIAAYHIQQTDGQLDRHW------------------TQPGVVTPQRLQDFWDKYDQTFFAEIRDEDVLADMIASVKALKAASPAA......... 310
22 -39.1004pgl_A mol:protein length:298 D-tagatose 3-epimerase  ali model follow..  13  3.KVGMFYSYWTEWMVDFPATAKRIAGLGFDLMEISLSEFHNL---SDAKKRELKAVADDLGLTVMCCEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVF---QHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEAYEQWLCNDAKEAIAFADAVDSPACKVHLDTFHMNIEENSFRDAILACKGKMGHFHLGE----------------------QNRLPPGEGRLPWDEIFGALKGYDGTIVIEPFMRTGGSVSRA..................... 258
23 -39.1002qw5_A mol:protein length:335 Xylose isomerase-like TIM barrel  ali model follow..  11  9SDIYISFFMFTTN--IVVAHIKKLQRFGYSGFEFPIAPGLPNYAQDLENYTNLRHYLDSEGLENVKISTNVGATYPEQRQEALEYLKSRVDITAALGGEIM---IWSDELQEHLKVRYANAQPILDKLGEYAEIKKVKLAIEPWETPGPNKLSQLIEFLKGVKSKQVGVVIDSAHEILDGEGPEIEYLAQQGRLHYVQVSP----------------------PDRGALHTSWLPWKSFLTPIVKYDGPIAVEIFNPNAYDIADEAIKVTRKELKKIGSK...... 335
24 -39.1004pfh_A mol:protein length:298 D-tagatose 3-epimerase  ali model follow..  12  3.KVGMFYTYWTEWMVDFPATAKRIAGLGFDLMEINLEEFHNL---SDAKKRELKAVADDLGLTVMCCEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVF---QHPPLDMVDKRPYVDRAIESVRRVIKVAEDYGIIYALEVYEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEENSFRDAILACKGKMGVFHIGE----------------------QNRLPPGEGRLPWDEIFGALKGYDGTIVMEPFMRTGGSVGRD..................... 258
25 -39.1003vyl_A mol:protein length:297 L-ribulose 3-epimerase  ali model follow..  11  2ARIGIHSFVWSAAQSELERTLANTRDAGFDLIEF------SYLDPADVDIGRLAKRIADLGLGVAISDGDISSADKAVAARGVEILNQTIALTRDLGGRKV---GHGLQVEAPTRDQWNRSAAALAKVAETAKAAGVTLNLEIFESNLLNTAAQGLAFIEDTGSDNIFLHLDTFHMNIEEADVGLAIRHAAGKIGYVHIGESHRG----------------------FLGTGNIDFAAIFDALTGYADDLSFESFSTDNMALAKHARAFIGLGLETARRKAE.... 289
26 -38.0003ju2_A mol:protein length:284 uncharacterized protein SMc04130  ali model follow..  12  7.GLSINLATIREQ-CGFAEAVDICLKHGITAIAPWRDQVAAI------GLGEAGRIVRANGLKLTGLGGFFPAPDASGREKAIDDNRRAVDEAAELGADCLVLVAGGLPGGSKNDAARRMVVEGIAAVLPHARAAGVPLAIEPADRACVNTLGQALDICETLG-PGVGVAIDVYHVWWDPDLANQIARA-MKAILAHHICDWLVPTKDMLTDRGM-------------MGDGVIDLKGIRRRIEGFHGAQEVEWWKRPADEVIATCVERYRNCCEG.......... 278
27 -37.7002q02_A mol:protein length:272 Putative cytoplasmic protein  ali model follow..  14  7TRFCINRKIAPG--LSIEAFFRLVKRLEFNKVELRNDMPSGSVTDDLN-YNQVRNLAEKYGLEIVTINAVYPFNQLT--EEVVKKTEGLLRDAQGVGARALVL----CPLNDGTIVPPEVTVEAIKRLSDLFARYDIQGLVEPFRVSSLRSAVWAQQLIREAGSP-FKVLLDTFHHHLYEEAEKEFASRIISAIGLVHLSGVEDTRPTEALADEQ---------RIMLSEKDVMQNYQQVQRLEGYRGIYAFEPFSSQLASWSEAEIEEQINRSVSLLLQ...... 272
28 -35.0001k77_A mol:protein length:260 Hypothetical protein ygbM  ali model follow..  14  1MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYN---------STLQIQKQLEQNHLTLALFGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEA-PHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHE----------------------DDGEINYPWLFRLFDGYQGWIGCEYKPRGLTE......................... 248
29 -34.4002g0w_A mol:protein length:296 Lmo2234 protein  ali model follow..  14  19ITISSYTLGTE---VSFPKRVKVAAENGFDGIGLRAENYVDAL-AAGLTDEDMLRILDEHNMKVTEVEYITQWGTAEDRAEQQKKEQTTFHMARLFGVKHINC-------GLLEKIPEEQIIVALGELCDRAEELII--GLEFMPYSGVADLQAAWRVAEACGRDNAQLICDTWHWARANQTAESIKNVPADRIVSIQLCDVHETPYKELREE--------SLHDRLAPGEGYGDTVGFAKILKGVNPRMGVEMVATGLEYAALKVYNATKKVLDEAWPEIS.... 288
30 -33.3003ngf_A mol:protein length:269 AP endonuclease, family 2  ali model follow..  14  3MPRFAANLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYD---------DADVIARELKQHNLTQVLFGERGMAAISGREQEFRDNVDIALHYALALDCRTLHAMSGITEGLD-RKACEETFIENFRYAADKLAPHGITVLVEP-PGYFIVHQLEAVGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHE----------------------DEGELNYPYLFSVLEGYRGWVGCEYNPRGKTE......................... 249
31 -32.6003ayt_A mol:protein length:254 Putative uncharacterized protein TTHB071  ali model follow..  13  1MDVRLAF-----PLSRAEEALPRLQALGLG-AEVY------LDPALLEEDALFQSLRRRFSGKLSVHLPFWNLDLLSPRGLTLRRLLFGLDRAAELGADRAVFHSGIPHTPEEALERALPLAEALGLVVRRARTLGVRLLLEN----SHEPHPEALRPVLEAHAGELGFCFDAAHARVFSRTP-DPGPWLALAPEHLHLND-----------------TDGVYDRHWNLGRGVLGHGAWLRPYL--DRTMVLE-----VREDPEASLAFLQALAGEGRTALDRLLM 251
32 -30.2003obe_A mol:protein length:305 Sugar phosphate isomerase/epimerase  ali model follow..  12  21KKMGLQTYSLGQELQDMPNGLNRLAKAGYTDLEIFGYREDTGKFGDYNASKDYKKMVDDAGLRISSLTPSLREYTKENMPKFDEFWKKATDIHAELGVSCMVQ------PRIENEDDAKVVSEIFNRAGEITKKAGILWGYHNHSNEFKRVLKAGEKFLKNTDPDKVMFELDVYWAVMGQQDPVEWMENYPNRFKLLHIKDR-----------------------WIIGDSGMMNFPNIFKKAYEIG-GYYVELEGRTQFEGVEKSAAYLQAA............. 301
33 -26.6003l23_A mol:protein length:303 Sugar phosphate isomerase/epimerase  ali model follow..  11  15IGLQIYSLSQELYKGDVAANLRKVKDMGYSKLELAGYGKGAIGGVP---MMDFKKMAEDAGLKIISFKAMIFKYSKEVTPKIMEYWKATAADHAKLGCKYLIQ------PTITTHDEAKLVCDIFNQASDVIKAEGIATGFHNHNMEFNRVATKEQQMLKDTDPSKVYFEMDVYWTVMGQNDPVEYMQKHPDRIKVLHIKDRA-----------------------VFGQSGMMNFEMIFKQMYANG-DYFVELEGRTQFAGVKDCADYLIKA............. 299
34 -24.0003ktc_A mol:protein length:333 Xylose isomerase  ali model follow..  16  8PEFGAGLWHFAGPALSTIDQINAAKEVGLSYVDL------PYPFTPGVTLSEVKDALKDAGLKAIGITGAFTNPDPAARAAAFELMHESAGIVRELGANYVKVWPGQDG-QVSHKNLWKLAVDGMRDLAGANPDVKFAI--EPRVKMTWDSAARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIRGRLFGMDVNDNLRGWDDDLV--------------------GTVHMTEIFEFFYNWQGVWQLD-FRENHVEAAQLSIRFLKHIYRALDKLDIPALQ 306
35 -17.1003aam_A mol:protein length:270 Endonuclease IV  ali model follow..  12  16................VAGAVEEATALGLTAFQIFAKSPRSPRALSPAEVEAFRALREASGGPAVIHASYL--AEGELWEKSVASLADDLEKAALLGVEYVVVHPGS-GRPERVKEGALKALRLAG------VRSRPVLLVENTAGGGEKVGARFEELAWLVADTPLQVCLDTCHAYAAGYDVAEDPLGV-ERVPVVHLNDSVGG--------------GSRVDHHAHLLQGKIGLKRVFLDPRLKDRVFILE--TPRGPEEDAWNLRVFRAWLEEA......... 270
36 -16.7003xim_A mol:protein length:393 D-XYLOSE ISOMERASE  ali model follow..  15  33..............LDPVEAVHKLAEIGAYGITFHDDDLGSDAQTRDGIIAGFKKALDETGLIVPMVTTNLTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREG-AKDVSAALDRYREALNLLAQYSEDRGLRFAIEPKPNILLPTAGHAIAFVQELERPEFGINPETGHEQMSNLNFTQGIAQAHKKLFHIDLNG..................................................................................... 247
37 -16.1001bhw_A mol:protein length:393 XYLOSE ISOMERASE  ali model follow..  14  33..............LDPVEAVHKLAEIGAYGITFHDDDLGSDAQTRDGIIAGFKKALDETGLIVPMVTTNLTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREG-AKDVSAALDRYREALNLLAQYSEDRGLRFAIEPKPNILLPTAGHAIAFVQELERPEFGINPETGNEQMSNLNFTQGIAQAHKKLFHIDLNG..................................................................................... 247
38 -15.4001qtw_A mol:protein length:285 ENDONUCLEASE IV  ali model follow..  12  14................LANAAIRAAEIDATAFALFTKNQRQAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALD--KTQGVTAVIENTAGNLGFKFEHLAAIIDGVDKSRVGVCIDTCHAFAAGYDLRKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHS--------LGEGNIGHDAFRWIMQD----LILE---TINPDIWAEEIAWLKAQQTEKAVA...... 285
39 -15.3004hno_A mol:protein length:288 Probable endonuclease 4  ali model follow..  17................FDRVPQDTVNIGGNSFQIFPHNARSAKLPSDEAATKFKREMKKHGIDWENAFCHSGYPKDDIWQKSVELLKKEVEICRKLGIRYLNIHPGS---GTGEEEGIDRIVRGLNEVLN--NTEGVVILLENVSQNIGYKLEQLKKIRDLVDRDRVAITYDTCHGFDSGYDLLNEIESL-ERLKMIHLNDSKYP--------------GAAKDRHERIGSGFIGEEGFAVFFSF----VPWILETPGGNEEHAEDIKKVFEIIEKFGIE...... 288
40 -14.6001bxb_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  16  36.................VYVVHKLAELGAYGVNLHDEDLGTPPQERDQIVRRFKKALDETGLKVPMVTANLTSPDPWVRAYALRKSLETMDLGAELGAEIYVVWPGREGATGKARKVWDWVREALNFMAAYAEDQGYRFALEPKPNIYFATVGSMLAFIHTLDRPEFGLNPEFAHETMAGLNFVHAVAQAAGKLFHIDLND..................................................................................... 247
41 -14.6001bxc_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  15  36.................VYVGHKLAELGVHGVNLHDEDLGTPPQERDQIVRRFKRALDETGLKVPMVTGNLTSRDPWVRAYAFRKSLETMDLGAELGAEIYVVWPGREGATGKARKVWDWVREPLNFMAAYAEDQGYRFALEPKPNIYFATVGSMLALIHTLERPEFGLNPEFAHETMAGLNFVHAVAQAAGKLLHIDLNG..................................................................................... 247
42 -14.2002hcv_A mol:protein length:438 L-rhamnose isomerase  ali model follow..  66....FARFPGTGEPRGIFDKLDDCAV--IQQLTRATPNVSLHIPWDKADPKELKARGDALGLGFDAMNGSLSHTNAATRAQAVEHNLECIEIGKAIGSKALTVWIGD-PGQSNFTRAFERYLSAMAEIYKGLPD-DWKLFSEHKM-STVVQDWGTNYLIAQTLGPKAQCLVDLGHHA-PNTNIEMIVARLIQFLGGFHFNDSKYGDDDLDAGAIEPY-----------------RLFLVFNELVDAEARGVKGFHPAHMIDQSHNVTDPIESLINSANEIRRAYAQ 352
43 -14.2001did_A mol:protein length:394 D-XYLOSE ISOMERASE  ali model follow..  14  10FTFGLWTVGWTGADLDPVEAVHKLAELGAYGITFHDNDLDATEAEREKILGDFNQALKDTGLKVP-KDGGFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGSSKDLAAALDRMREGVDTAAGYIKDKGLRIALEPKPNIFLPTVGHGLAFIEQLEHGDVGLNPETGHEQMAGLNFTHGIAQAAEKLFHIDLNG..................................................................................... 247
44 -13.9004lnc_A mol:protein length:388 Xylose isomerase  ali model follow..  14  34..............LDPVESVRRLAELGAHGVTFHDDDLGSSDSEREEHVKRFRQALDDTGMKVP-KDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPNILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQAAGKLFHIDLNG..................................................................................... 248
45 -13.9004hhl_A mol:protein length:388 Xylose isomerase  ali model follow..  13  34..............LDPVEAVQRLAELGAYGVTFHDDDLGASDTEREAHVKRFRQALDATGMTVP-KDGAFTANDRDVRRYALRKTIRNIDLAVELGAKVYVAWGGREGAAKDVRAALDRMKEAFDLLGEYVTSQGIRFAIEPKPNILLPTIGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQAAGKLFHIDLNG..................................................................................... 248
46 -13.8001gw9_A mol:protein length:388 XYLOSE ISOMERASE  ali model follow..  14  34..............LDPVESVQRLAELGAHGVTFHDDDLGSSDSEREEHVKRFRQALDDTGMKVP-KDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPNILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQAAGKLFHIDLNG..................................................................................... 248
47 -13.8006xia_A mol:protein length:387 D-XYLOSE ISOMERASE  ali model follow..  14  33..............LDPVESVRRLAELGAHGVTFHDDDLGSSDSERYEHVKRFRQALDDTGMKVP-KDGGFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGAAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPNILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQAAGKLFHIDLNG..................................................................................... 247
48 -13.7001dxi_A mol:protein length:388 D-XYLOSE ISOMERASE  ali model follow..  13  34..............LDPVETVQRLAELGAYGVTFHDDDLGSSDTERESHIKRFRQALDATGMTVP-KDGGFTANDRDVRRYALRKTIGNIDLAAELGAKTYVAWGGREGAAKDVRDALDRMKEAFDLLGEYVTAQGLRFAIEPKPNILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQAAGKLFHIDLNG..................................................................................... 248
49 -13.7001muw_A mol:protein length:386 XYLOSE ISOMERASE  ali model follow..  13  33..............LDPVETVQRLAELGAHGVTFHDDDLGSSDTERESHIKRFRQALDATGMTVP-KDGGFTANDRDVRRYALRKTIRNIDLAVELGAKTYVAWGGREGAAKDVRVALDRMKEAFDLLGEYVTSQGIRFAIEPKPNILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQAAGKLFHIDLNG..................................................................................... 247
50 -13.7003aal_A mol:protein length:303 Probable endonuclease 4  ali model follow..  11  6LKIG-SHVSMSGKKM-LLAASEEAASYGANTFMIYTGAPQNTKSIEELNIEAGRQHMQAHGIEIVVHAPYINTTNLDTFSLGVDFLRAEIERTEAIGAKQLVLHPGA---GAGVEAGLRQIIRGLNEV--LTREQNVQIALETMAGECGRTFEELAYIIDGVANDKLSVCFDTCHTHDAGYDIVNDFDGVLGRLKVLHINDSKNP-------------RGSRKDRHENIGFGHIGFAALNYQLEDIPKILETPYVGEDKNNKKPPYKHEIAMLRAQSFDDQ..... 293
51 -13.6001clk_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  13  33..............LDPAESVRRLAELGAHGVTFHDDDLGATDSERAEHIKRFRQALDETGMKVP-KDGGFTANDRDVRRYALRKTIRNIDLAVELGAQTYVAWGGREGAAKDVRVALDRMKEAFDLLGEYVTSQGTPFAIEPKPNILLPTIGHALAFIDGLERPEYGVNPEVGHEQMAGLNFPHGIAQAAGKLFHIDLNG..................................................................................... 247
52 -13.3001xp3_A mol:protein length:307 endonuclease IV  ali model follow..  13  19................LLAASEEAVSYGATTFMIYTGAPQNTKPIEELNIEAGRKHMEQNGIEIIIHAPYINTTKPETFQLGVDFLRMEIERTSALGVAKQIVLHPGAHVGAGADAGIQQIIKGLNEV--LTPDQTVNIALETMAGECGRSFEEIAKIIDGVKNEKLSVCFDTCHTHDAGYDIVNNFDGVIDRLQVLHINDSKNV-------------RGAGKDRHENIGFGHIGYKALHHQLTHVPKILETPYVGEDKKDKYKLEIEMLKNGTFDEGLLEKIKAQ 301
53 -12.9001tz9_A mol:protein length:367 Mannonate dehydratase  ali model follow..  12  5MKWGFRWYGAAGDAIPLKHIRQIP---GITGVVGTLLNKLPGDVWTVAEIQALKQSVEQEGLAIESVAIHDAIKATDQRDHYIDNYRQTLRNLGKCGISLVENEDGSLSAGVTEEDLVENLRYFLERVIPVCEEENIKMGIHPDD--ITKNLADLKRILSLVDSPANGITFCTGSLADPTNDLPTMIREIGHRINFVHFRNVKYLGEHRFEETAHPSV------------AGSLDMAELMQALVDVGYEGVIR................................. 319
54 -10.4004eac_A mol:protein length:414 Mannonate dehydratase  ali model follow..  13  30....................LADVRQAGATGVVTALHHIPNGEVWSVEEILKRKAIIEDAGLVVESVPIHEDIKTTGNYEQWIANYQQTLRNLAQCGIRTVNIIAGLPGAEEDKAKLRENFAVFLKAIIPVAEEVGVRMAVHPDD--IVSTIEDMQWMVDTVNSMANGFTMCTGSYVRADNDLVDMIKQFGPRIYFTHLRSTMREDNPKTFHEAAHL-------------NGDVDMYEVVKAIVEEEHRRKAEGKEDLIPMRPDHGHQMLDDLKKKTNPG...... 381
55 -10.2003ban_A mol:protein length:386 D-mannonate dehydratase  ali model follow..  12  15MKMSFRWYG-KKDPVTLEEIKAIP---GMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEIESIPVHEDIKQKPNRDALIENYKTSIRNVGAAGIPVVKAIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDD--IITGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTE-RNRINFMHTRNVTAGAWGFQETAHLS-------------QAGDIDMNAVVKLLVDYDWQGSLR................................. 322

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.