current user: public




3dx5A
Query: 3dx5_A mol:protein length:286 uncharacterized protein AsbF, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MKYSLCTISFRHQLISFTDIVQFAYENGFEGIELWGTHAQNLYMQEYETTERELNCLKDKTLEITMISDYLDISLSADFEKTIEKCEQLAILANWFKTNKIRTFAGQKGSADFSQQERQEYVNRIRMICELFAQHNMYVLLETHPNTLTDTLPSTLELLGEVDHPNLKINLDFLHIWESGADPVDSFQQLRPWIQHYHFKNISSADYLHVFEPNNVYAAAGNRTGMVPLFEGIVNYDEIIQEVRDTDHFASLEWFGHNAKDILKAEMKVLTNRNLEVVTSENLYFQLast
1 -90.9003dx5_A mol:protein length:286 uncharacterized protein AsbF  ali model  100  1MKYSLCTISFRHQLISFTDIVQFAYENGFEGIELWGTHAQNLYMQEYETTERELNCLKDKTLEITMISDYLDISLSADFEKTIEKCEQLAILANWFKTNKIRTFAGQKGSADFSQQERQEYVNRIRMICELFAQHNMYVLLETHPNTLTDTLPSTLELLGEVDHPNLKINLDFLHIWESGADPVDSFQQLRPWIQHYHFKNISSADYLHVFEPNNVYAAAGNRTGMVPLFEGIVNYDEIIQEVRDTDHFASLEWFGHNAKDILKAEMKVLTNRNLEVVTSENLYFQ 286
2 -67.2002zds_A mol:protein length:340 Putative DNA-binding protein  ali model follow..  15  3RNFTLFTGQWAD--LPLEEVCRLARDFGYDGLELACWGDHDKALADPSYVDSRHQLLDKYGLKCWAISNHLVGQAEGVRQRAAAEIKDTARAAARLGVDTVIGFTGSAIPESMIERGYQDFADRWNPILDVFDAEGVRFAHEVHPSEIAYDYWTTHRALEAVGRPAFGLNFDPSHFVWQDLDPVGFLWDFRDRIYHVDCKEARKRGRNGRLGSHLPWGDPRRGWDFVSAGHGDVPWEDVFRMLRSIDYQGPVSVEWEDRLQGAPEALTRLKAFDFEPPSAS..... 325
3 -62.7003cny_A mol:protein length:301 Inositol catabolism protein IolE  ali model follow..  15  10IKWGIAPIGWRNDDINLQQLLSDIVVAGFQGTEVGGFFP---------GPEKLNYELKLRNLEIAG-QWFSSYIIRDGIEKASEAFEKHCQYLKAINAPVAVVSEQFKDKPYFTDKEWDEVCKGLNHYGEIAAKYGLKVAYHHHMGTGIQTKEETDRLMANTDPKLVGLLYDTGHIAVSDGDYMALLNAHIDRVVHVHFKDVRRSKEEECRAKGLTFQGSFLNGMFTVPGDGDLDFKPVYDKLIANNYKGWIVVEAENPLEMAQIAHRYIKQHLIE.......... 300
4 -60.9003cqh_A mol:protein length:295 L-ribulose-5-phosphate 3-epimerase ulaE  ali model follow..  11  11IPLGIYEKALP-AGECWLERLQLAKTLGFDFVEMSVDETDSRLDWSREQRLALVNAIVETGVRVPSMCLSLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYDVYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNV-----------------PFGEGVVDFERCFETLKQSGYCGPYLIEAEDPAAEVAKARDWVKARMAKAGMVEAA... 289
5 -60.8003tva_A mol:protein length:290 Xylose isomerase domain protein TIM barrel  ali model follow..  15  11WPIGVFTSV----DAGLGVHLEVAQDLKVPTVQVHAPHPHT---RTREHAQAFRAKCDAAGIQVTVIFGGVGLVPLETRASRVAEMKEISDFASWVGCPAIGLHIGFVPES--SSPDYSELVRVTQDLLTHAANHGQAVHLETGQ----ESADHLLEFIEDVNRPNLGINFDPANMILYGGNPIEALRKVARYVRSIHCKDALWAPVNE---------RGKSWGQEVALGTGDVGMEAYLTTLWEIGYRGPLTIEPVQQKKDLASALELLTGLRKKIAN....... 289
6 -57.0001yx1_A mol:protein length:264 hypothetical protein PA2260  ali model follow..  6HPVSISLSSYGADSRGQASFLPLLAMAGAQRVELREEL------AGPPDTEALTAAIQLQGLECVFSSPLELWREDGQLN---PELEPTLRRAEACGAGWLKVSLGLLPEQ-----------PDLAALGRRLARHGLQLLVENDQTPQGGRIEVLERFFRLAERLDLAMTFDIGNWRWQEQAADEAALRLGRYVGYVHCKAVIRN----------------RDGKLVAVPPSAADLQYWQRLLQHFPEGVARAIEGDDLLSLSRRHIAALARLGQPQEERQH.... 261
7 -54.5001i60_A mol:protein length:278 IOLI PROTEIN  ali model follow..  10  1MKLCFNEATTL-ENSNLKLDLELCEKHGYDYIEIRTMDKL-PEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKSSVDVLTELSDIAEPYGVKIALEGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHAMGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVW-----------PGQGAIDLDAHLSALKEIGFSDVVSVELFRPEYYKLTAEEAIQTAKKTTVD....... 270
8 -54.3003u0h_A mol:protein length:281 Xylose isomerase domain protein  ali model follow..  11  4MEPCLHPTLVDE--TSLVLYLDLARETGYRYVDVPFHWLEAEA--ERHGDAAVEAMFQRRGLVLANLGLPLNLYDSEPFLRELSLLPDRARLCARLGARSVTAFLW-PSMDEEPVRYISQLARRIRQVAVELLPLGMRVGLEYRRYPFVQSLADLKTFWEAIGAPNVGALVDSYHWYTAGEHEDDLAQLPPEKVVYVHINDTRDAPEDAHDGKRLL------------PGDGRIPLVPFLRGLYLAGYRGPVAAEDGTGESRARLVRERLEKLIALAKG....... 281
9 -53.8003p6l_A mol:protein length:262 Sugar phosphate isomerase/epimerase  ali model follow..  17  10WRLGMQSYSFHL--FPLTEALDKTQELGLKYIEIYPGDKVFDFNLDAQTQKEIKELAASKGIKIVGTGVYVAEKSSD--------WEKMFKFAKAMDLEFITC---------------EPALSDWDLVEKLSKQYNIKISVHNHPQPSDYWKPENLLKAISGRSQSLGSCSDVGHWRREGLNQIDCLKQLKGRIISLHFKDIAPKK------------AGENEQHDVIWGTGILDVKGMLKELKSQNFKGVFSIEYENSVPDIKECIQYFNKTANEI......... 261
10 -53.4003lmz_A mol:protein length:257 Putative sugar isomerase  ali model follow..  18FHLGMAGYTFVN--FDLDTTLKTLERLDIHYLCIKDFH---PLNSTDEQIRAFHDKCAAHKVTGYAVGP--------IYMKSEEEIDRAFDYAKRVGVKLIVGVPN---------------YELLPYVDKKVKEYDFHYAIHLHGPDIKTYPDATDVWVHTKDDPRIGMCLDVGHDLRNGCDPVADLKKYHTRVFDMHIKDVT---------------DSSKAGVGIEIGRGKIDFPALIRMMREVNYTGMCSLEYEDPFLGIAESIGYFKAVSDLT......... 257
11 -51.4003obe_A mol:protein length:305 Sugar phosphate isomerase/epimerase  ali model follow..  12  21KKMGLQTYSLGQELQDMPNGLNRLAKAGYTDLEIFGYREDNPKNTTFIASKDYKKMVDDAGLRISSSHLTPSLREYENMPKFDEFWKKATDIHAELGVSCMVQPSL---PRIENEDDAKVVSEIFNRAGEITKKAGILWGYHNHSNEFKRVLKAGEKFLKNTDPDKVMFELDVYWAVMGQQDPVEWMENYPNRFKLLHIKDR-----------------------WIIGDSGMMNFPNIFKKAYEIGILGYVELEGDTQFEGVEKSAAYLQAA............. 301
12 -51.1002zvr_A mol:protein length:290 Uncharacterized protein TM_0416  ali model follow..  11  15MKLSLVISTSDAAKGDLRKGMELAKRVGYQAVEIAVRDPSIV------DWNEVKILSEELNLPICAIGTSLTHPNDEIRKKAIERVVKHTEVAGMFGALVIIGLVRGRREGRSYEETEELFIESMKRLLELTEHAKFVIPLNRYETDFINTIDDALRILRKINSNRVGILADTFHMNIEEVNIPESLKRAGEKLYHFHVADSNRWA----------------------PGCGHFDFRSVFNTLKEIGYNRYVSVEPGGMEEAAEIAFKTLKELIIKLT........ 284
13 -50.3001k77_A mol:protein length:260 Hypothetical protein ygbM  ali model follow..  13  2PRFAA-NLSMMFTEVPFIERFAAARKAGFDAVEFLFPYNYST--------LQIQKQLEQNHLTLALFNTAPGSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEAKPHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHE---------------------PDDGEINYPWLFRLFDEVGYQGWIGCE---PRGLTEEGLGWFDA.............. 256
14 -50.1003kws_A mol:protein length:287 Putative sugar isomerase  ali model follow..  12  26LKLSFQEGIAPGE--SLNEKLDFMEKLGVVGFEPGGGG-------LAGRVNEIKQALNGRNIKVSAICAGFKSTDPAIRKECMDTMKEIIAAAGELGSTGVIIVPGQVPALPHTMETRDFLCEQFNEMGTFAAQHGTSVIFEPKECFYLRQVADAASLCRDINNPGVRCMGDFWHMTWEETSDMGAFISGGEYLQHVHVASRKRRSMPGE-------------------DGDADNYINGFKGLKMIGYNNYVSFEQGDRNVVVPAAVKLLREQWEQA......... 287
15 -50.1003VNI Entity 1(prereleased)  ali follow..  12  2MKHGIYYAYWEQEEADYKYYIEKVAKLGFDILEIAA---SPLPFYSDIQINELKACAHGNGITLTVGHGNLSSPDPDIRKNAKAFYTDLLKRLYKLDVHLISYWPIDYTKTIDKKGDWERSVESVREVAKVAEACGVDFCLEVFENYLINTAQEGVDFVKQVDHNNVKVMLDTFHMNIEEDSIGGAIRTAGSYLGHLHTGECNRKV----------------------PGRGRIPWVEIGEALADIGYNGSVVMEEKMLDREAQAALDFSRYVLECHKHS...... 294
16 -49.8002ou4_A mol:protein length:290 D-tagatose 3-epimerase  ali model follow..  10  3.KVGMFYTYWSTEMVDFPATAKRIAGLGFDLMEISL---GEFHNLSDAKKRELKAVADDLGLTVMCCIGLFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANR----------------------LPPGEGRLPWDEIFGALKEIGYDGTIVMEDEEMDERARRSLQFVRDKLA........... 290
17 -49.0003ju2_A mol:protein length:284 uncharacterized protein SMc04130  ali model follow..  12  1MSLQVEGLSINLATIGFAEAVDICLKHGITAIAPW------RDQVAAIGLGEAGRIVRANGLKLTGLGGFFPAPDASGREKAIDDNRRAVDEAAELGADCLVLVAGGLPGGSKNDAARRMVVEGIAAVLPHARAAGVPLAIEPADRACVNTLGQALDICETLG-PGVGVAIDVYHVWWDPDLANQIARAGMKAILAHHICDWLVPTKDMLTDRG-------------MMGDGVIDLKGIRRRIEAAGFHGAQEVEKRPADEVIATCVERYRNCCE........... 277
18 -49.0002hk0_A mol:protein length:309 D-PSICOSE 3-EPIMERASE  ali model follow..  13  16MKHGIYYSYWEHESAKFGPYIEKVAKLGFDIIEVAAHHINEY---SDAELATIRKSAKDNGIILTAGIGNLSSEDAAVRAAGKAFFERTLSNVAKLDIHTISYWPIDYSQPVDKAGDYARGVEGINGIADFANDLGINLCIEVFENHVLNTAAEGVAFVKDVGKNNVKVMLDTFHMNIEEDSFGDAIRTAGPLLGHFHTGESNRRV----------------------PGKGRMPWHEIGLALRDINYTGAVIMEIAKMDEDARNALAFSRFVLG........... 303
19 -48.7003ngf_A mol:protein length:269 AP endonuclease, family 2  ali model follow..  13  4PRFAA-NLSTMFNEVPFLERFRLAAEAGFGGVEFLFPYDFDA--------DVIARELKQHNLTQVLFNMPPGAAISGREQEFRDNVDIALHYALALDCRTLHAMSGIT-EGLDRKACEETFIENFRYAADKLAPHGITVLVEPMPGYFIVHQLEAVGLVKRVNRPNVAVQLDLYHAQIMDGDLTRLIEKMNGAFSHVQIASVPDRHE---------------------PDEGELNYPYLFSVLESVGYRGWVGCE---PRGKTESGLAWFAPYRDQSA........ 263
20 -48.4003l23_A mol:protein length:303 Sugar phosphate isomerase/epimerase  ali model follow..  12  13KEIGLQIYSLSQEKGDVAANLRKVKDMGYSKLELAGYGKGAIGGVPM---MDFKKMAEDAGLKIISSHVNPVDTSISDTPKIMEYWKATAADHAKLGCKYLIQPMM---PTITTHDEAKLVCDIFNQASDVIKAEGIATGFGYHNAFMKVGDQIYDLMLKDTDPSKVYFEMDVYWTVMGQNDPVEYMQKHPDRIKVLHIKDRA-----------------------VFGQSGMMNFEMIFKQMYANGIKDYVELEGRTQFAGVKDCADYLIKA............. 299
21 -48.0002q02_A mol:protein length:272 Putative cytoplasmic protein  ali model follow..  12  7TRFCINRKIAPG--LSIEAFFRLVKRLEFNKVELRN-DMPSGSVTDDLNYNQVRNLAEKYGLEIVTINAVYPF--NQLTEEVVKKTEGLLRDAQGVGARALVLCPLNDGT----IVPPEVTVEAIKRLSDLFARYDIQGLVEGFRVSSLRSAVWAQQLIREAGSP-FKVLLDTFHHHLYEEAEKEFASRIISAIGLVHLSGVEDTRPTEALADEQ---------RIMLSEKDVMQNYQQVQRLENMGYRGIYAFEEAEIEEQINRSVSLLLQ.............. 272
22 -47.2002qw5_A mol:protein length:335 Xylose isomerase-like TIM barrel  ali model follow..  10  9SDIYISFFMFTTNRRIVVAHIKKLQRFGYSGFEFPIAPGLENYAQDLENYTNLRHYLDSEGLENVKISTNVGSNYPEQRQEALEYLKSRVDITAALGGEIMMGPIVSDELQEHLKVRYANAQPILDKLGEYAEIKKVKLAIEPWETPGPNKLSQLIEFLKGVKSKQVGVVIDSAHEILDGEGPQVEYLAQQGRLHYVQVSPPDRG----------------------ALHTSWLPWKSFLTPIVK-VYDGPIAVEYPNAYDIADEAIKVTRKELKKIGS....... 334
23 -45.4002g0w_A mol:protein length:296 Lmo2234 protein  ali model follow..  12  17CPITISSYTL-GTEVSFPKRVKVAAENGFDGIGLRAENYVDALA-AGLTDEDMLRILDEHNMKVTEVEYITQWTAEDRTAEQQKKEQTTFHMARLFGVKHINCGLLEKIPE-------EQIIVALGELCDRAEELIIGL--EFMPYSGVADLQAAWRVAEACGRDNAQLICDTWHWARANQTAESIKNVPADRIVSIQLCDVHETPYKELREE--------SLHDRLAPGEGYGDTVGFAKILKEHGVNPGVEVVATGLEYAALKVYNATKKVLDEAWPE...... 286
24 -44.2003qxb_A mol:protein length:316 Putative Xylose isomerase  ali model follow..  14MKLGVNLCFAVKRLEPDRLAGLVRDDLGLEYVQYTY-DPWWPDIERDRRAIAYAKAFRKAGLTIESTFGHFLAPTLELQSLGYQHLKRAIDMTAAMEVPATGMPFGSYSNPARREEIYAIARDMWIELAAYAKRQGLSMLYATEFPSSAADAARLMADLDGRTEIPVRLLVDWGHALFEPADMDHWMDLCQPWIAAYHIQQTDGQLDRHW-------------------QPGVVTPQRLQDFWDKYALTDQTEARDEDVLADMIASVKALKAASPAA......... 310
25 -41.4003xim_A mol:protein length:393 D-XYLOSE ISOMERASE  ali model follow..  11  8DKFSFGLWTVGWQALDPVEAVHKLAEIGAYGITFHDDDLVSDAQTRDGIIAGFKKALDETGLIVPMVTTGFTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREGSAKDVSAALDRYREALNLLAQYSEDRGYGLRFAIEPDILLPTAGHAIAFVQELERPEFGINPETGHEQMSNLNFTQGIAQALWKLFHIDLNG----------------QHGPKFDQDLVFGHGDLLNAFSLVDLLENGPDGAPAYDGPRHFDYKPSRTEDYDGVWESARANIRMYLL 316
26 -41.4003ktc_A mol:protein length:333 Xylose isomerase  ali model follow..  11  8PEFGAGLWHFANYIDRYDQINAAKEVGELSYVDL------PYPFTPGVTLSEVKDALKDAGLKAIGITPAFTNPDPAARAAAFELMHESAGIVRELGANYVKVWPGQDPFQVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKPRVKMTWDSAARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIIDRLFGMDVNDNLRGWDDDLV-----------------VGTVHTEIFEFFYVLKINNWQGVWQLDRENHVEAAQLSIRFLKHIYRALDKLDI.... 302
27 -39.6001bxb_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  10  8HRFTFGLWTVGNVRLDPVYVVHKLAELGAYGVNLHDEDLITPPQERDQIVRRFKKALDETGLKVPMVTANLTSPDPWVRAYALRKSLETMDLGAELGAEIYVVWPGREGATGKARKVWDWVREALNFMAAYAEDQGYRFALEPKPDIYFATVGSMLAFIHTLDRPRFGLNPEFAHETMAGLNFVHAVAQALDKLFHIDLND----------------QRMSRFDQDLRFGSENLKAFFLVDLLESSGYQGPRHFDRTEDEEGVWAFARGCMRTYLILKERAEAFRE 321
28 -39.5001bxc_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  8HRFTFGLWTVGNVRLDPVYVGHKLAELGVHGVNLHDEDLITPPQERDQIVRRFKRALDETGLKVPMVTGGFTSRDPWVRAYAFRKSLETMDLGAELGAEIYVVWPGREEATGKARKVWDWVREPLNFMAAYAEDQGYGYRFEPRGDIYFATVGSMLALIHTLERPRFGLNPEFAHETMAGLNFVHAVAQALDAGKLLHIDLNGQR--------------MNRFDQDLRFGSENLKAFLLVDLLESSGYQGPRHFDRTEDEEGVWAFARGCMRTYLILKERAEAFRE 321
29 -39.0001clk_A mol:protein length:387 XYLOSE ISOMERASE  ali model follow..  10  8DKFTFGLWTVGWQALDPAESVRRLAELGAHGVTFHDDDLIATDSERAEHIKRFRQALDETGMKVPMATTNFTANDRDVRRYALRKTIRNIDLAVELGAQTYVAWGGREGAAKDVRVALDRMKEAFDLLGEYVTSQGYDTPFAIEPDILLPTIGHALAFIDGLERPEYGVNPEVGHEQMAGLNFPHGIAQALWAGKLFHIDLNGQS--------------GIKYDQDLRFGPGDLRAFWLVDLLESAGYEGPRHFDRTEDFDGVWASAAGCMRNYLILKERAAAFRA 321
30 -39.0006xia_A mol:protein length:387 D-XYLOSE ISOMERASE  ali model follow..  11  8DRFTFGLWTVGWEALDPVESVRRLAELGAHGVTFHDDDLISSDSERYEHVKRFRQALDDTGMKVPMATTNFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGGAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPDILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQALWKLFHIDLNGQNGIKYDQ-----------------LRFGAGDLAAFWLVDLLESAGYSGPRHFDRTEDFDGVWASAAGCMRNYLILKERAAAFRA 321
31 -38.7001tz9_A mol:protein length:367 Mannonate dehydratase  ali model follow..  11  5MKWGFRWYGAAGDAIPLKHIRQIP---GITGVVGTLLNKLPGDVWTVAEIQALKQSVEQEGLALLGIES----AGTDQRDHYIDNYRQTLRNLGKCGISLVCY-LKAMYAGVTEEDLVENLRYFLERVIPVCEEENIKMGIHPDDPRITKNLADLKRILSLVDSPANGITFCTGSLADPTNDLPTMIREIGHRINFVHFRNVKYLGEHRFEE------------TAHPSVAGSLDMAELMQALVDVGYEGVIRPDHGRAIYDRAMGLTYIQGLYEATKAKQN.... 359
32 -38.6004E3V Entity 1(prereleased)  ali follow..  11  9DRFTFGLWTVGWQGLDPVESVRRLAELGAHGVTFHDDDLISSDSEREEHVKRFRQALDDTGMKVPMATTNFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGGAKDVRDALDRMKEAFDLLGEYVTSQGIRFAIEPKPDILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQALWKLFHIDLNGQNGIKYDQ-----------------LRFGAGDLRAFWLVDLLESAGYSGPRHFDRTEDFDGVWASAAGCMRNYLILKERAAAFRA 322
33 -38.5001gw9_A mol:protein length:388 XYLOSE ISOMERASE  ali model follow..  11  9DRFTFGLWTVGWQGLDPVESVQRLAELGAHGVTFHDDDLISSDSEREEHVKRFRQALDDTGMKVPMATTNFTANDRDVRRYALRKTIRNIDLAVELGAETYVAWGGREGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIEPDILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQALWAGKLFHIDLNGQN--------------GIKYDQDLRFGAGDLRAFWLVDLLESAGYSGPRHFDRTEDFDGVWASAAGCMRNYLILKERAAAFRA 322
34 -38.4001muw_A mol:protein length:386 XYLOSE ISOMERASE  ali model follow..  10  8DRFTFGLWTVGWQGLDPVETVQRLAELGAHGVTFHDDDLISSDTERESHIKRFRQALDATGMTVPMATTNFTANDRDVRRYALRKTIRNIDLAVELGAKTYVAWGGREGAAKDVRVALDRMKEAFDLLGEYVTSQGYDIRFAIEPDILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQALWKLFHIDLNG----------------QSGIKYDQDLRFGAGDLAAFWLVDLLESAGYEGPRHFDRTEDIDGVWASAAGCMRNYLILKERAAAFRA 321
35 -38.1001bhw_A mol:protein length:393 XYLOSE ISOMERASE  ali model follow..  12  8DKFSFGLWTVGWQALDPVEAVHKLAEIGAYGITFHDDDLVPDAQTRDGIIAGFKKALDETGLIVPMVTTNLTSNDRSVRRYAIRKVLRQMDLGAELGAKTLVLWGGREGSAKDVSAALDRYREALNLLAQYSEDRGYGLRFEPRGDILLPTAGHAIAFVQELERPEFGINPETGNEQMSNLNFTQGIAQALWKLFHIDLNGQHGPKFDQ-----------------LVFGHGDLLNAFSLVDLLENGPDGAPAYDGTEDYDGVWESAKANIRMYLLLKERAKAFRA 326
36 -37.9001dxi_A mol:protein length:388 D-XYLOSE ISOMERASE  ali model follow..  11  9DRFTFGLWTVGWQGLDPVETVQRLAELGAYGVTFHDDDLISSDTERESHIKRFRQALDATGMTVPMATTNFTANDRDVRRYALRKTIGNIDLAAELGAKTYVAWGGREGGAKDVRDALDRMKEAFDLLGEYVTAQGLRFAIEPKPDILLPTVGHALAFIERLERPEYGVNPEVGHEQMAGLNFPHGIAQALWKLFHIDLNGQSGIKYDQDLRFG---------------AGDLRAAFWLVDLLETAGYEGPRHFDRTEDFDGVWASAAGCMRNYLILKDRAAAFRA 322
37 -36.9003ban_A mol:protein length:386 D-mannonate dehydratase  ali model follow..  10  15MKMSFRWYG-KKDPVTLEEIKAIP---GMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESI--KQGKPNRDALIENYKTSIRNVGAAGIPVVCYIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDDPRIITGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYRNRINFMHTRNVTAGAWG--------------QETAHLSQAGDIDMNAVVKLLVDYDWQGSLRPDHGRGLYDRALGATYFNGLYEANMRAAG.... 363
38 -35.2001did_A mol:protein length:394 D-XYLOSE ISOMERASE  ali model follow..  11  9.HFTFGLWTVGWTNLDPVEAVHKLAELGAYGITFHDNDLIATEAEREKILGDFNQALKDTGLKVPMVTTNFTSNDRSIRRFALAKVLHNIDLAAEMGAETFVMWGGREGGSKDLAAALDRMREGVDTAAGYIKDKGLRIALEPKPDIFLPTVGHGLAFIEQLEHGDVGLNPETGHEQMAGLNFTHGIAQALEKLFHIDLNGQRGIKYDQ-----------------LVFGHGDVDLLENGFPNGGPKYTGPRHFDRTDGYDGVWDSAKANMSMYLLLKERALAFRA 327
39 -34.8003ayt_A mol:protein length:254 Putative uncharacterized protein TTHB071  ali model follow..  11  1MDVRLAF--------RAEEALPRLQALGLG-AEVY------LDPALLEEDALFQSLRRRFSGKLSVHLPFWNLPDPEVRGLTLRRLLFGLDRAAELGADRAVFHSGIPHGPEEALERALPLAEALGLVVRRARTLGVRLLLEN----SHEPHPEALRPVLEAHAGELGFCFDAAHARVFSRTP-DPGPWLALAPEHLHLNDTDGVYDRHW-----------------NLGRGVLGHGAWLRPYLDRTMVLEVREDPEASLAFLQALAGEGRTALDRLLMGER.... 254
40 -26.3001a0d_A mol:protein length:440 XYLOSE ISOMERASE  ali model follow..  79...............RVEAAFEFFEKLNIPFFCFHDVD-KETYKNLDIIVDMIEEYMKTSKTKLLWNTGAATSCNADVFAYAAAKVKKGLEIAKRLGAENYVFWGGREG-NTDMKLELDNLARFLHMAVDYAKEIGGQFLIEPKPKQYDFDVATALAFLQTYGLKDFKFNIEANHATLAGHTFEHELRVARIMLGSVDANQGDMLLGWDTD----------------EFPTDLYSTTLAMYEILKNGGLGRVRRGSFEPEDLFYAHIAGMDSFAVGLKVAHRLIED 373
41 -26.0001a0e_A mol:protein length:443 XYLOSE ISOMERASE  ali model follow..  10  79.............FARVDALFEFCEKLNIEYFCF-GKTLRETNKILDKVVERIKERMKDSNVKLLWGTAAATTCSADVFAYAAAQVKKALEITKELGGEGYVFWGGREG-NTDLGFELENLARFLRMAVDYAKRIGGQFLIEPKPKQYDFDVATAYAFLKSHGLDEFKFNIEANHATLAGHTFQHELRMARGKLGSIDANQGDLLLGWDTDQ-----------------PTNVYDTTLAMYEVIKAGFDAKVRRASYKVEDLFIGHIAGMDTFALGFKVAYKLVKD 375
42 -24.7001a0c_A mol:protein length:438 XYLOSE ISOMERASE  ali model follow..  82................VEAAFEFFDKINAPYFCF-GDTLRETNKNLDTIVAMIKDYLKTSKTKVLWGTANLTSCNADVFAYSAAQVKKALEITKELGGENYVFWGGREGLNTDMEFELDNFARFLHMAVDYAKEIGGQFLIEPKPKQYDFDVANVLAFLRKYDLDKFKVNIEANHATLAFHDFQHELRYARIVLGSIDANTGDMLLGWDTDQFP---------------TDIRMTTLAMYEVIKMGGFDAKVRRASFEPEDLFLGHIAGMDAFAKGFKVAYKLVKD 375
43 -24.6002hcv_A mol:protein length:438 L-rhamnose isomerase  ali model follow..  66....FARFPGTGEPRGIFDKLDDCAVIQ--QLTRATPNVSLHIPWDKADPKELKARGDALGLGFDAMNSSLSHTNAATRAQAVEHNLECIEIGKAIGSKALTVWIGNFPGQSNFTRAFERYLSAMAEIYKGLPD-DWKLFSEHKMYSTVVQDWGTNYLIAQTLGPKAQCLVDLGHHAPNTNEMIVARLIQFGKLGGFHFNDSKYGDDDLDAG-----------------AIEPYRLFLVFNELVDAEARGVKGFHPAHMIDQSHNVTDPIESLINSANEIRRAYAQ 352
44 -21.0003aam_A mol:protein length:270 Endonuclease IV  ali model follow..  10  16................VAGAVEEATALGLTAFQIFAKSPRSPRALSPAEVEAFRALREASGGLPAVIHASY-GAEGELWEKSVASLADDLEKAALLGVEYVVVHPG-SGRPERVKEGALKALRLAGVR------SRPVLLVENTAGGGEKVGARFEELAWLVADTPLQVCLDTCHAYAAGYDVAEDPLGV-ERVPVVHLNDSVGG--------------GSRVDHHAHLLQGKIGEGLKRVFLDPRLKDRVFILETPRGPEEDAWNLRVFRAWLEEA......... 270
45 -20.7001qtw_A mol:protein length:285 ENDONUCLEASE IV  ali model follow..  10  14................LANAAIRAAEIDATAFALFTKNQRQAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLITEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALD--KTQGVTAVIENTAGNLGFKFEHLAAIIDGVEKSRVGVCIDTCHAFAAGYDLRKTFADF-KYLRGMHLNDAKST--------------GSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA...... 285
46 -20.1001xp3_A mol:protein length:307 endonuclease IV  ali model follow..  13  19................LLAASEEAVSYGATTFMIYTGAPQNRKPIEELNIEAGRKHMEQNGIEAPYIINVGNTTKPETFQLGVDFLRMEIERTSALGVAKQIVLHPGAHVGAGADAGIQQIIKGLNEVLT--PDQTVNIALETMAGECGRSFEEIAKIIDGVKNEKLSVCFDTCHTHDAGYDIVNNFDGV-DRLQVLHINDSKNV--------------GAGKDRHENIGFGHIGYKALHHIVHHTHVPKILETDKKDKKPPYKLEIEMLKNGTFDEGLLEKIKAQ 301
47 -19.6002x7v_A mol:protein length:287 PROBABLE ENDONUCLEASE 4  ali model follow..  14................FDRVPQDTVNIGGNSFQIFPHNARSAKLPSDEAATKFKREMKKHGIDWENAFCHSGYLIDDIWQKSVELLKKEVEICRKLGIRYLNIHPG-SHLGTGEEEGIDRIVRGLNEVLN--NTEGVVILLENVSQNIGYKLEQLKKIRDLVDRDRVAITYDTCHGFDSGYDITALLNEI-ERLKMIHLNDSKYP--------------GAAKDRHERIGSGFIGEEGFAVFFSFKEIQE-WILETPGGNEEHAEDIKKVFEIIEKFGIEVD.... 287
48 -19.2003bww_A mol:protein length:307 Protein of unknown function DUF692/COG3220  ali model follow..  11  15................AEGFLQLRNNDRIQFMEI---APENWIKMGGFARYQFDKVAEKIPILIHGLSLSLGGQAPLDK----ELLSSIKAMIKQYNTPFFSDHLSFCECDGHLYDTDEAVKHTAARIREVQDFLEIQISVENTSYYLHSETSTMNELNAIVQEANCGIHLDVNNIYVNAVDPHVFIDNVLKRVNYIHIAGHDDEHAAT---------------EVQIQTSESFNKIKGDLRHLPP---TLLERDFNFPPEKLCKEVDIIHQLQQKYVKKRG.... 301
49 -19.1003aal_A mol:protein length:303 Probable endonuclease 4  ali model follow..  12  20................LLAASEEAASYGANTFMIYTGAPQNRKSIEELNIEAGRQHMQAHGIEEIVVHAPGNTTNLDTFSLGVDFLRAEIERTEAIGAKQLVLHPG-AHVGAGVEAGLRQIIRGLNEVLT--REQNVQIALETMAGECGRTFEELAYIIDGVANDKLSVCFDTCHTHDAGYDIVNDFDGV-GRLKVLHINDSKNP--------------GSRKDRHENIGFGHIGFAALNYIVHHEDIPKILETDKNNKKPPYKHEIAMLRAQSFDDQLLEKINAG 301
50 -15.8002j6v_A mol:protein length:301 UV ENDONUCLEASE  ali model follow..  13IRLGYPCENLTLGATTNRRILRFNADHGFALFRIGQH-PYDWEGAYEEELARLGALARAFGQRLSMHPGQPGSPDPEVVERSLAELRYSARLLSLLGAEDGVLVLHLGGAYGEKGKALRRFVENLRGEEEVLRYLALE-----------ERLWNVEEVLKAAEALGVPVVVDTLHHALNPEEALRLAFPTWRGRPKVHLASQDPKKRPGAHAF--------------------VTREDWERLLSALPGPADVMVEAKGKEQGLAT..................... 290
51 -13.8003UVA Entity 1(prereleased)  ali follow..  11  58....DVTGDYPGKATTPEELRMDLEKAGKHRVNLHAIYAEERDQLEPRHFEKWVRWAKRHGLGLDFNGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELTNIWIPDGYKDTPSDTPRKRLKESLDQIFAAEINEANLDAVESGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYH-PTETVSNKISAMFHDKLALHVSR..................................................................................... 288
52 -13.1003p14_A mol:protein length:424 L-rhamnose isomerase  ali model follow..  12  59.....VTGDYPGKATTPEELRMDLEKAGKHRVNLHAIYAEERDQLEPRHFEKWVRWAKRHGLGLDKDGLTLAHPDQAIRQFWIDHCIASRKIGEYFGKELETPCLGYKDTPSDRLTPRKRLKESLDQIFAAEINEANLDAVESGIGSESYVVGSHEFYLSYALKNDKLCLLDTGHYH-PTETVSNKISAMFHDKLALHVSR..................................................................................... 288
53 -11.1001d8w_A mol:protein length:426 L-RHAMNOSE ISOMERASE  ali model follow..  10  61....QATGNYPGKARNASELRADLEQAGPKRLNLHAIYLESRDQIKPEHFKNWVEWAKANQLGLDFNPSTLSHADDSIRQFWIDHCKASRRVSAYFGEQVMNIWIPDGMKDITVDAPRQRLLAALDEVISKLNPAHHIDAVESGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFH-PTEVISDKISAAMLYQLLLHVSRPVRWDSDHVVL-------------------LDDETQAIASEIVRHDLFDRVHIASINRIAAWVIGTRNMKKALLRALLEPT.... 358
54 -10.6002cw6_A mol:protein length:298 Hydroxymethylglutaryl-CoA lyase, mitochondria  ali model follow..  31..................KLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPN----------------LKGFEAAVAAGAKEVVIFGAASETKKNINCSIEESFQRFDAILKAAQSANISV--PYEGKISPAKVAEVTKKFYSMGCYEISL--DTIGV--TPGIMKDMLSAVMQEVPLVHCHDTYGQALANTLMALQMGVSVVDSSVYAQGASGNLATEDLVYMLEGLGIHTGVNLQK------LLEAGNFICQALNRKTSSKVA... 292
55 -10.6001ydo_A mol:protein length:307 HMG-CoA Lyase  ali model follow..  10  32..................TWINQLSRTGLSYIEITSFVHPKWIPALRDAIDVAKGIDREKGVTYAALVPN----------------QRGLENALEGGINEACVFMSASENRKNINKSTSESLHILKQVNNDAQKANLTT--PYEKDVPIEQVIRLSEALFEFGISELSL--DTIGA--NPAQVETVLEALLARFPALHFHDTRGTALANMVTALQMGITVFDGSAYAPGSSGNAATEDIVYMLEQMDIKTNVKLEK------LLSAAKWIEEKMGKPLPSRNLQV. 295
56 -10.5001tvn_A mol:protein length:293 cellulase  ali model follow..  10  10......................................................NQILAGGENTSFAGPSLFWSNTGWGAEKFYTAETVAKAKTEFNATLIRAIGHGTSTGGSLNFDWEGNMSRLDTVVNAAIAEDMYVIIDFHSHEAHTDQATAVRFFEDVATQYDNVIYEIYNEPLQISWVNDIKPYAETVIDKIRAID----PDNLIVVGTPTWSQDVDVASQNPIDRANISYRNKAQTALDNGIALFAEWGTVNADGNGGVNINETDAWMAFFKTNNISHA. 254
57 -10.1001ydn_A mol:protein length:295 HYDROXYMETHYLGLUTARYL-COA LYASE  ali model follow..  30..................ALINRLSDCGYARIEATSFVSPKWVPQLADSREVMAGIRRADGVRYSVLVPN----------------MKGYEAAAAAHADEIAVFISASESKANINCTIAESIERLSPVIGAAINDGLAI--PYDGPVTPQAVASVTEQLFSLGCHEVSL--DTIGR--TPDTVAAMLDAVLAIAPAGHYHDTGGRALDNIRVSLEKGLRVFDASVFAPGAKGNVDTVAVVEMLHEMGFETGLDLDR------LRSAGLFTQALRQDKAALE..... 289
58 -10.1002ftp_A mol:protein length:302 hydroxymethylglutaryl-CoA lyase  ali model follow..  34..................RLVDDLSAAGLDYIEVGSFVSPKWVPQMAGSAEVFAGIRQRPGVTYAALAPN----------------LKGFEAALESGVKEVAVFAAASESQRNINCSIKDSLERFVPVLEAARQHQVRV--PYDGDVDPRQVAWVARELQQMGCYEVSL--DTIGV--TAGATRRLIEAVASEVPRGHFHDTYGQALANIYASLLEGIAVFDSSVYAKGATGNVASEDVLYLLNGLEIHTGVDMHA------LVDAGQRICAVLGKSNGSRA.... 294
59 -9.9501egz_A mol:protein length:291 ENDOGLUCANASE Z  ali model follow..  10......................................................NKIYAGEKAKSFAGNSLFWSNNGWGGEKFYTADTVASLKKDWKSSIVRA-AMGVQESGGYLQDPAGNKAKVERVVDAAIANDMYAIIGWHSHSAENNRSEAIRFFQEMARNKPNVIYEIYNEPLQVSWSNTIKPYAEAVISAIRAID----PDNLIIVGTPSWSQNVDEASRDPINAKNISLRNKARQALNNGIALFVEWGTVNADGNGGVNQTETDAWVTFMRDNNISNA. 252
60 -9.6603amc_A mol:protein length:317 Endoglucanase  ali model follow..  36.................DEFFDIIKEAGFSHVRIPIRWSTHAYAFPPYKIM----------------------------DRFFKRVDEVINGALKRGLAVVINIHHYEELMNDPEEHKERFLALWKQIADRYKDYPETLFFELTPEKWNELLEEALKVIRSIDKKHTIIIGTAEWGGISALEKLSVPKWEKNSIVTIHYYNFEFTHQGAEWVEGSEKWLGRKWGSPDDQKHLIEEFNFIEEWSKKNKRPIYIGEFGAYRKADLESRIKWTSFVVREMEK....... 278
61 -9.5003irs_A mol:protein length:291 UNCHARACTERIZED PROTEIN BB4693  ali model follow..  11  48...............SLELMFEEMAAAGIEQGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSI-------EAATRKEAMAQMQEILD----LGIRIVNLEPGVWATPMHVDD------RRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFPDLTVVSSHG---NWPWVQEIIHVAFRRPNLYL-SPDMYLYNLPGHADFIQAANSFLADRMLFGTA-CPLKEYTEWFLT------LPIKPDAMEKILHGNAERLLAQAGR.......... 283
62 -9.4202osw_A mol:protein length:481 Endoglycoceramidase II  ali model follow..  10  1MGSSSSGLVPRGSHMSGSGSGSGTALTPLRGFNTASSAKSAPDGMPQFTEADLAREYADMGTNFVRFLISWRSVEPAPDQQYLDRVEDRVGWYAERGYKVMRAFDNFWNTTGKHPELVEHYAKAWRAVADRFADNAYDLMNEPFGGSLQGPAQRTTDAIRQVDQDTWPQAIGVNQGLPSGLTKIDDPRAGQQRIAYPHLYPLPLDIGDGHEGLARTLTDVTIDAWR---------ANTAHTARVLGDVPIILEFGLDTTLPGARDYIERVYGTAREMGAGVSYWS. 368
63 -9.3303dxi_A mol:protein length:320 Putative aldolase  ali model follow..  1MSLKILDCTLRDGGYIVDAYILAMNELPIDYLEVGSKEYMGKFGYTPVSVLKHLRNISTKKIAIMLNEKNTTPEDLNHLLLPIIGLVDMIRIAID-----------------------PQNIDRAIVLAKAIKTMGFEVGFNVMYMSKWAEMNGFLSKLKAIDKIADLFCMVDSFGGITPKEVKNLLKEVRKYTHHGH-DNLQLGLINSITAIDDGIDFIDATITGMGRGAGNLKMELLLTYLNK......................................... 240
64 -9.2603nco_A mol:protein length:320 Endoglucanase FnCel5A  ali model follow..  44.................DEYFKIIKERGFDSVRIPIRWSAHISEKYPYEID----------------------------KFFLDRVKHVVDVALKNDLVVIINCHHFEELYQAPDKYGPVLVEIWKQVAQAFKDYPDKLFFELTPTKWNELYPKVLGEIRKTNPSRI-VIIDVPNWSNYSYVRELKLVDDKNIIVSFHYYEFNFTHQGAEWVSPTLPIGVKWEGKDWEVEQIRNHFKYVSEWAKKNNVPIFLGEFGAYSKADMESRVKWTKTVRRIAEE....... 285
65 -9.1501nvm_A mol:protein length:345 4-hydroxy-2-oxovalerate aldolase  ali model follow..  16LRDGSHAIRHQYTLDDVRAIARALDKAKVDSIEVAHGDGLQGSSFDLEYIEAVAGEISHAQIATLLLPG--------------IGSVHDLKNAYQAGARVVRVATHCTE------------ADVSKQHIEYARNLGMDTVGFLMMSHMIPAEKEQGKLMESYGATCIYMA-DSGGAMSM-NDIRDRMRAFKAVLKHAH-HNLSLGVANSIVAVEEGCDRVDASLAGMGAGAGNAPLEVFIAVAERLGWNHGTDLYT.............................. 259
66 -9.1401gzj_A mol:protein length:304 ENDO TYPE CELLULASE ENGI  ali model follow..  1......................................................KVFQWFGSNESGAEFGSQNLPGVEGKDYIWPDPNTIDTLISKGMNIFRV---RLVPNSMTGSPDPNYLADLIATVNAITQKGAYAVVDPHNNSIISSPSDFQTFWKTVASSNPLVIFDTNN---DQTLVLNLNQAAIDGIRSAGATSQYIFVEGNSWTGAWTWTNVNDNMKSLTDPSDKIIYEMHQYLDSDGSGTSATCVSSTIGQERITSATQWLRANGKKGIIGE..... 239
67 -9.0701h1n_A mol:protein length:305 ENDO TYPE CELLULASE ENGI  ali model follow..  1.......................AKVFQWFGSNESGAEFGSQNLPGVEGDPNTIDTLISKGMNIFRVPFMMERLVPNSMPNYLADLIATVNAITQKGAYAVVDPHNYGRYYNSIISSPSDFETFWKTVASQFASNPFDTDNEYHDTLVLNLNQAAIDGIRSAGATS-GNSWTGAWTWTNVNDNMKSLTDPSDKIIYMHQ---------------LDSDGSGTSATCVSSTIGQERITSATQWLRANGKKGIIGEFAGGADNVCETAITGMLDYMAQNTDV...... 266

FFAS is supported by the NIH grant R01-GM087218-01
6 1 1 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Schwarzenbacher R, Godzik A, Jaroszewski L. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches. Acta Crystallogr D Biol Crystallogr. 2008 Jan;64(Pt 1):133-40. Epub 2007 Dec 5.