current user: public




Query: 3cje_A mol:protein length:167 OsmC-like protein, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst GMALTPDQMPDRAEVVFTCNGKAVGKMRNELDVAMVKPFEERFALATDEGAFHGGDASAPPPLALFIAGLTGCVMTQIRAFAKRLKVTVTDLDVECRVVWDWAKAGPVYETGPKSFEIDIILHSPDPIEAQQALIEAAKKGCFLEQTLGQANTIRHRLKVGDTFIDALast
1 -95.6003cje_A mol:protein length:167 OsmC-like protein  ali model  100  1GMALTPDQMPDRAEVVFTCNGKAVGKMRNELDVAMVKPFEERFALATDEGAFHGGDASAPPPLALFIAGLTGCVMTQIRAFAKRLKVTVTDLDVECRVVWDWAKAGPVYETGPKSFEIDIILHSPDPIEAQQALIEAAKKGCFLEQTLGQANTIRHRLKVGDTFIDA 167
2 -76.3002opl_A mol:protein length:187 Hypothetical protein  ali model follow..  14  18ATIEQIKAKPEIAQFKFRATNQWMGGTHNQATIKDFYGARKPMVFDLDEPPVLLGENRGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGEVPVGYREIRVFFSIDADLTDGQKEELIRMAQKYSPVYNTVAKPVPVAVLLDRG...... 187
3 -69.0001lql_A mol:protein length:166 osmotical inducible protein C like family  ali model follow..  15  15.......YFQGHMDKKYDITAVLNEDSSMTAIS-------DQFQITLDARP--KHTAKGFGPLAALLSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDG--YFGLREINLHWEIHSPNSETEIKEFIDFVSKRCPAHNTLQGVSQLKINVNVT...... 157
4 -52.9002pn2_A mol:protein length:155 Uncharacterized protein  ali model follow..  15  33.......................................QSNNEIITDAPVDNQGKGEAFSPTDLLATSLASCMLTIIGIKARDMEIDIAGTTAEVTKVMAAD------PRRVSEVHIAITFNQELDDKTQKIFYNTALT-CPVAKSIHPDIFQKVIIH........ 145
5 -47.8002onf_A mol:protein length:140 Hypothetical protein Ta0195  ali model follow..  15  1............GMHVYESDVSWIDDRRTEVS-------VGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAELGPS---PEKGFKFHRIKIHVKIGNDEDKEKIPRAMQLAEKYCFISRAIRNNVEEIVDYEF....... 139
6 -31.9001vla_A mol:protein length:150 Hydroperoxide resistance protein OsmC  ali model follow..  16  21......................................TDSNHDVLMDTKEEVGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVQMKDFRIEIEYER-----TEEHPRIFTKVHLKYIFDGEPPKDKVEKAVQLQEKYCSVSAILKCSSKVTYEIVYEN..... 144
7 -31.2002e8c_A mol:protein length:132 Hypothetical protein Aq_1549  ali model follow..  10  20...............................................TSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKR-----REKHPKIYEEIEIKYVAVGKVEEKALEQAVKLTEKYCSVLAMVKPSTNLKISWEVKWE.... 131
8 -30.3003eer_A mol:protein length:148 Organic hydroperoxide resistance protein, put  ali model follow..  16  10.............STIYQTSATASAGRNGVVSTED-----KLLELNLSYPKEMGGSGTATNPEQLFAVGYAACFSNAILHVAREAKVALKEAPVTATVGI------GPNGQGGFALSVALAAHIALEDEQARQLVTVAHQVCPYSNAVRGNIDVQVSVN........ 144
9 -27.9001ml8_A mol:protein length:134 hypothetical protein (crp region)  ali model follow..  16  17......................................SASGHQILMD-----NSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSER-----READTRLFTHINLHFIVTGDLKDAAVARAVDLAEKYCSVALMLEKAVNITHSYEVVAA.... 134
10 -26.8002ql8_A mol:protein length:143 Putative redox protein  ali model follow..  11  3.......QDERWNHPLYTTTAINDEELEGHAYI------PGGLKVQTSSP---MNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTAVRVKVAFIGARAEYQ--------LVHAQVMVKG-VDFDTAKAFTNEIENRCPVSKLLKNSGNYTIETVTD...... 140
11 -25.9002bjo_A mol:protein length:136 ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB  ali model follow..  15  2..............ALFTAKVTARGGRAGHITSDD-----GVLDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDEGQVSLMKDESDGGFK--------GVTLVVNTKD-LDREKAQELVNAAHEFCPYSKATRGNVDVKLELK........ 136
12 -24.8001usp_A mol:protein length:139 ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN  ali model follow..  18  2.............ANVYTAEATATGGRAGTTRSSD-----DRLNLDLSVPAEMGGDGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPA-----DSTITARVGLQKAGLAFADVELEGHFPG-LSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVR........ 138
13 -24.7001n2f_A mol:protein length:142 Organic Hydroperoxide Resistance Protein  ali model follow..  20  5.............KALYTATATATGGRDGRAVSSD-----GVLDVKLSTPREMGGQGAATNPEQLFAAGYSACFIGAMKFVAGQRKQTLPA-----DASITGKVGIGQIPGGFGEVELHINLPG-MEREAAEALVAAAHQVCPYSNATRGNIDVRLNVSV....... 142
14 -24.4004noz_A mol:protein length:149 Organic hydroperoxide resistance protein  ali model follow..  19  7.............KVLYRAHAKATGGRDGRATVPE-----SGLDLKLTTPRELGGAGAGANPEQLFAAGYSACFIGAMKFVAARDKIAIPA-----DAAIEGSVGIGAIPNGFGEVELKISLPG-LDRDIAQTLIDRAHVVCPYSNATRGNIDVTLTLV........ 143
15 -24.2004xx2_A mol:protein length:163 Organic hydroperoxide resistance protein  ali model follow..  17  20.............KVLYTAIVTATGGRDGSVVSSD-----NVLNVKLSVPQGLGGPGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPA-----EPRVEGRVGIGEIPGGFGVVELRIAVSG-MERSMLQTLVDKAHRVCPYSNATRGNIDVVLILI........ 156
16 -24.0001ukk_A mol:protein length:142 Osmotically Inducible Protein C  ali model follow..  19  39......................................................EEGEGTNPEELIAAAHAGCFSMALAASLEREGFPPKRVSTEARVHLEVVD------GKPTLTRIELLTEAEISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARL....... 141
17 -23.4001nye_A mol:protein length:162 Osmotically inducible protein C  ali model follow..  20  56......................................................EGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVD------AGFAITKIALKSEVAIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLK........ 157
18 -22.1004mh4_A mol:protein length:147 OsmC-like protein  ali model follow..  15  8.............KVLYTGKTHTTSGGRD----GAARSSDGRLDIQLSSP---GSAGTGTNPEQLFAAGWSACFIGAMQLAARAAKVTLPA-----DLAVDAEVDLGTAGNAY-QARLNVSVPG-LERDVAQRIVDAAHQTCPYSKATRGNIDVDIRIA........ 141
19 -21.3002d7v_A mol:protein length:162 Hypothetical protein VCA0330  ali model follow..  11  10...............EHSAIVTWKRKDSEAFTDNQY---SRAHTWEFDGGSKI-SVEANVDPEEAFVAALSSCHMLVFLSIAAKQRYLVESYTDNAVGILGKN---SKGKTSVTKVVLRPQVTSKPTLQQLEKMHHLAHENCFIANSVETEVVTE............ 159

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.