current user: public




3cjeA
Query: 3cje_A mol:protein length:167 OsmC-like protein, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst GMALTPDQMPDRAEVVFTCNGKAVGKMRNELDVAMVKPFEERFALATDEGAFHGGDASAPPPLALFIAGLTGCVMTQIRAFAKRLKVTVTDLDVECRVVWDWAKAGPVYETGPKSFEIDIILHSPDPIEAQQALIEAAKKGCFLEQTLGQANTIRHRLKVGDTFIDALast
1 -92.5003cje_A mol:protein length:167 OsmC-like protein  ali model  100  1GMALTPDQMPDRAEVVFTCNGKAVGKMRNELDVAMVKPFEERFALATDEGAFHGGDASAPPPLALFIAGLTGCVMTQIRAFAKRLKVTVTDLDVECRVVWDWAKAGPVYETGPKSFEIDIILHSPDPIEAQQALIEAAKKGCFLEQTLGQANTIRHRLKVGDTFIDA 167
2 -71.5002opl_A mol:protein length:187 Hypothetical protein  ali model follow..  14  18ATIEQIKAKPEIAQFKFRATNQWMGGTHNQATICAEDDTRKPMVFDLDEPPVLLGENRGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGEVPVGYREIRVFFSIDADLTDGQKEELIRMAQKYSPVYNTVAKPVPVAVLLDRG...... 187
3 -61.0001lql_A mol:protein length:166 osmotical inducible protein C like family  ali model follow..  16  1.MGSSDYDIPTTENLYFQGHMDKKYDITAVLNEDSMTAISDQFQITLDARP--KHTAKGFGPLAALLSGLAACELATANLMAPAKMITINKLLMNVTGSRSTNPTDG--YFGLREINLHWEIHSPNSETEIKEFIDFVSKRCPAHNTLQGVSQLKINVNV....... 156
4 -60.1001vla_A mol:protein length:150 Hydroperoxide resistance protein OsmC  ali model follow..  15  1............MGSDKIMQARWIGNMMFHVRT------DSNHDVLMDTKEEVGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVIDQMKDFRIEIEYERTEEHPRIFTKV-HLKYIFKFDGEPPKDKVEKAVQLSEKYCSVSAILKCSSKVTYEIVYEN..... 144
5 -59.5002pn2_A mol:protein length:155 Uncharacterized protein  ali model follow..  14  12.............QGMTTSKVTYQGDLRTSAIH-----LQSNNEIITDAPVDNQGKGEAFSPTDLLATSLASCMLTIIGIKARDMEIDIAGTTAEVTKVMA------ADPRRVSEVHIAITFNQELDDKT-QKIFYNTALTCPVAKSIHPDIFQKVIIHSKS..... 148
6 -58.1003eer_A mol:protein length:148 Organic hydroperoxide resistance protein, put  ali model follow..  15  1....SNAMRNKNMSTIYQTSATASAG-----RNGVVSTEDKLLELNLSYPKEMGGSGTATNPEQLFAVGYAACFSNAILHVAREAKVALKEAPVTATVGIGPNG------QGGFALSVALAAHIALEDEQARQLVTVAHQVCPYSNAVRGNIDVQVSVNGLA..... 147
7 -56.1002onf_A mol:protein length:140 Hypothetical protein Ta0195  ali model follow..  14  1............GMHVYESDVSWIDDRRTEVS-------VGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAELGPSPEKG----KFHRIKIHVKIGNDEDKEKIPRAMQLAEKYCFISRAIRNNVEEIVDYEF....... 139
8 -55.1002e8c_A mol:protein length:132 Hypothetical protein Aq_1549  ali model follow..  11  7..................................ELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRR-----EKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSEKYCSVLAMVKPSTNLKISWEVKWE.... 131
9 -49.6001ml8_A mol:protein length:134 hypothetical protein (crp region)  ali model follow..  15  1................MQARVKWVEGLTFLGE------SASGHQILMDG----NSGDKAPSPMEMVLMAAGGCSAIDVVSILQKGRQDVVDCEVKLTSERREAD-----TRLFTHINLHFIVTGDLKDAAVARAVDLSEKYCSVALMLEKAVNITHSYEVVAA.... 134
10 -44.9001usp_A mol:protein length:139 ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN  ali model follow..  21  1............MANVYTAEATATGG-----RAGTTRSSDDRLNLDLSVPAEMGGDGPGTNPEQLFAAGYAACFQGALGVVSRRQKIDVPASTITARVGLQKAG-----LAFALDVELEGHFPG-LSREQAEGLMHAAHEVCPYSAATRNNVDVRLKVR........ 138
11 -44.8001nye_A mol:protein length:162 Osmotically inducible protein C  ali model follow..  15  14..........GHMTIHKKGQAHWEGDIKR---KGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITK--IALKSEVAVPG-IDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLK........ 157
12 -44.8002d7v_A mol:protein length:162 Hypothetical protein VCA0330  ali model follow..  11  2.......SFGGKSMSEHSAIVTWKRKDSE-SRAHTWEFDGGSKILASASPHVVLSVEANVDPEEAFVAALSSCHMLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVRPQVVFSGTSKPTLQQLEKMHHLAHENCFIANSVETEVVTEII.......... 161
13 -44.6001zb8_A mol:protein length:143 organic hydroperoxide resistance protein  ali model follow..  17  1........MNSLEKVLYTAIVTATGG-----RDGSVVSSDNVLNVKLSVPQGLGGPGSGTNPEQLFAAGYSACFIGALKFVANKEKVDLPA-EPRVEGRVGIGEIPG---GFGLVVELRIAVSG-MERSMLQTLVDKAHRVCPYSNATRGNIDVVLILI........ 142
14 -44.5002bjo_A mol:protein length:136 ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB  ali model follow..  16  2..............ALFTAKVTARGG-----RAGHITSDDGVLDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDS-EIEGQVSLMKDESDG---GFKIGVTLVVNTKD-LDREKAQELVNAAHEFCPYSKATRGNVDVKLELK........ 136
15 -44.3001ukk_A mol:protein length:142 Osmotically Inducible Protein C  ali model follow..  16  2..............PVRKAKAVWEGGLRQ--GKGVMELQSQAFQGPYSYPSRFEE-GEGTNPEELIAAAHAGCFSMALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTR--IELLTEAEVPG-ISSEKFLEIAEAAKEGCPVSRALAGVKEVVLTARL....... 141
16 -42.6001n2f_A mol:protein length:142 Organic Hydroperoxide Resistance Protein  ali model follow..  20  2..........QTIKALYTATATATGG-----RDGRAVSSDGVLDVKLSTPREMGGQGAATNPEQLFAAGYSACFIGAMKFVAGQRKQTLADASITGKVGIGQIP-----GGFGLEVELHINLPG-MEREAAEALVAAAHQVCPYSNATRGNIDVRLNVSV....... 142
17 -39.2002ql8_A mol:protein length:143 Putative redox protein  ali model follow..  13  1GM-----QDERWNHPLYTTTAINDEELEGHAYI------PGGLKVQTSSP---MNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHT-GAVRVKVAFIGAR-----AEYQFLVHAQVMVKG-VDFDTAKAFTNEIENRCPVSKLLKNSGNYTIETVTDFK.... 142

FFAS is supported by the NIH grant R01-GM087218-01
5 9 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.