current user: public




3chvA
Query: 3chv_A mol:protein length:284 Prokaryotic domain of unknown function (DUF84, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst GMDTPANKPCIICVAITGSVPTKADNPAVPITVSEQVESTQEAFEAGAAIAHCHVRNDDGTPSSDPDRFARLTEGLHTHCPGMIVQFSTGGRSGAGQARGGMLPLKPDMASLSVGSNNFPSRVYENPPDLVDWLAAQMRSYRVTPEIEAFDLSHILRAIDMHGRGLLYGKLYVQFVMGVKNAMPADREVFDFYVRMMRTRAPQAEWCAAGIGANQLTVNEWAIAAGGHTRTGLEDNIRLDRQTLAPSNAALVRRSVELCDKYQRPVASWQQAREILGLPAAARNLast
1 -119.0003chv_A mol:protein length:284 Prokaryotic domain of unknown function (DUF84  ali model  100  1GMDTPANKPCIICVAITGSVPTKADNPAVPITVSEQVESTQEAFEAGAAIAHCHVRNDDGTPSSDPDRFARLTEGLHTHCPGMIVQFSTGGRSGAGQARGGMLPLKPDMASLSVGSNNFPSRVYENPPDLVDWLAAQMRSYRVTPEIEAFDLSHILRAIDMHGRGLLYGKLYVQFVMGVKNAMPADREVFDFYVRMMRTRAPQAEWCAAGIGANQLTVNEWAIAAGGHTRTGLEDNIRLDRQTLAPSNAALVRRSVELCDKYQRPVASWQQAREILGLPAAARN 284
2 -114.0003fa5_A mol:protein length:282 protein of unknown function (DUF849)  ali model follow..  75  1GMSDPAGKPCIICVAITGSLPTKENNPAVPITLAEQVESTHEAFEAGASIAHCHVRDDEGRPTSDPDRFAALKEGLERHCPGMIVQLSTGGRSGAGQARGAMLPLCPDMASLSVGSNNFPTRVYENPPDLVDWLAAEMLKYDIKPEIEAFDLSHILQAKRMAGDGRLAGTPYVQFVMGVRNAMPADRDVFDYYIHTVRRFGEDAPWCAAGIGPSQIVLNEWAISSGGHARTGLEDNVRLDRDRLAPSNAALVGRAVELCEKYERPVATWRQARQILGLRM.... 281
3 -113.0003no5_A mol:protein length:275 Uncharacterized protein  ali model follow..  65  1....GMNKPCIISVAITGSLPRKKDNPAVPITVSEQVESTQAAFEAGATLVHLHVRNDDETPTSNPDRFALVLEGIRKHAPGMITQVSTGGRSGAGNERGAMLSLRPDMASLATGSVNFPTRVYDNPPELVDWLAAEMKTYGIKPEVEAFDLSMIFQAAAMQAAGAIVGPLHIQFVMGIKNAMPVDREVLEFYVQTLKRLSPDATWTGAGIGRHQLTMARWSLELGGHCRTGLEDNVRLDKNTLAPSNAALVRQVAELCEEYGRPVATAAQAREIMSL...... 274
4 -109.0002y7d_A mol:protein length:282 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME  ali model follow..  36  2.......EPLILTAAITGAETTRADQPNLPITPEEQAKEAKACFEAGARVIHLHIREDDGRPSQRLDRFQEAISAIREVVPEIIIQISTGGAVGSFDKRLAPLALKPEMATLNAGTLNFGDDIFINHPADIIRLAEAFKQYNVVPEVEVYESGMVDAVARLIKKGIIQNPLHIQFVLGVPGGMSGKPKNLMYMMEHLKEEIPTATWAVAGIGRWHIPTSLIAMVTGGHIRCGFEDNIFYHKGVIAESNAQLVARLARIAKEIGRPLATPEQAREILALNK.... 276
5 -105.0003e02_A mol:protein length:311 uncharacterized protein DUF849  ali model follow..  27  1GM--KQSKKIIITCAVTGSIHTPTMSPYLPITPEEIVKEGVAAAEAGAAMLHLHARDPNGRPSQDPDLFMRFLPQLKERTDAILNITTGGGLGMSLDERLAARAARPEVASMNMGSLNFNDFILSNTFSQIERGMTELGASGTRFEFECYDVGHLYNLAHFVDRKLVEPPFFLQCVFGILGGIGADPENLLHMRTIADRFGQDYYLSVLAAGRHQMPFVTMSAILGGNVRVGLEDSLYSGKGQLATSNAEQVRKIRRIIEELSLDIATPDEARAMLKTKGANET 309
6 -104.0003lot_A mol:protein length:314 uncharacterized protein  ali model follow..  28  1GM--RKDDVVIVTCAITGAIHTPSMSPYLPVTPDQIVEEAVKAAEAGAGMVHIHARDPDGRPTTDVEVFRYICREIKKQSDVVINVTTGGGGTPVEERAKVVPALKPEIATFNMGSMNFADIVFRNTFKDLEALSRIFKENDTKPELECYDIGQIYNTAFMFHEGYLEPPLRLQFIHGILGGIGTAVEDVLFMKQTADRLRENYTWSLVGAGRFQMPLGTLAVIMGGDVRVGLEDSLYIERGKLAKSNAEQVEKMVRIVKELGKRPATPDEVREILGLKGKERV 312
7 -104.0003e49_A mol:protein length:311 uncharacterized protein DUF849 with a TIM bar  ali model follow..  28  1GM--GSSRKVIITCAVTGAIHTPSMSPYLPVTPDEVAQASIGAAEAGAAVIHLHARDPDGRPTQDPAAFAEFLPRIKSNTDAVINLTTGGSPHMTVEERLRATHYMPELASLNMGSMNFGDLVFKNTFADIEFILKTCGGNGTRFEFECYDTSHLYNLAHFVDRKLATPPFFVQTVFGLLGGIGPHPEDLAHMRRTADRFGADYVWSILGAGRHQIPLASIGAAQGANVRVGLEDSLWIAPGELAETNAAQVRKIRQVIEGLSLEVASPAEARTMLGLKGPQNV 309
8 -99.1003c6c_A mol:protein length:316 3-keto-5-aminohexanoate cleavage enzyme  ali model follow..  28  10.YFQGMSRKVILTCAVTGNAPFNPKHPSMPITPAQIADACVEAAKAGASVAHIHVRDPTGGGSRDPVLFKEVVDRVRSSGTDIVLNLTCGLGAPVAERVKHLEDCLPEIASLDITTGNQVEFVYLNTTRTLRAMARRFQELGIKPELEVFSPGDILFGKQLIEEGLIDGVPLFQMVLGVLWGAPASTETMIYQRNLI---PANAQWAAFGIGRDQMPMMAQAALLGGNVRVGLEDNLYLSRGVFA-TNGQLVERARTVIEHLGMSVATPDEARDIMGLSRPA.. 310
9 -9.7903t7v_A mol:protein length:350 methylornithine synthase PylB  ali model follow..  56GNRVFLNCFIYFS-CSFCYYNCRNEINRYRLTMEEIKETCKTLKGAGFHMVDL----TMGEDPYYYEDPNRFVELVQIVKEELGLPIMISPGLMDNATLLKAREKGANFLALYQETYDYRKLRVGQSFDGRVNARRFAKQQGYCVEDGIL-ILSLRGMSTNDPDMVRVMTFLPQEGTPLEGFRDKSNLSELKIISVLRLMFPKRLIPA-SLDLEGIDGMVLRLNAGANIVTSILPPDSQLEGRDLEERDRDIKSVVRRLEIMGMKPARQADFEAVLGC...... 350
10 -8.3001m5w_A mol:protein length:243 Pyridoxal phosphate biosynthetic protein pdxJ  ali model follow..  15  2.......AELLLGVNID-ATLRNARGTAYP----DPVQAAFIAEQAGADGITVHLR-EDRRHITDRD-----VRILRQ----TLDTRMNLEMAVTEEMLAIAVETKPHFCCL--EVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFI-DEEQIKAAAEV-------GAPFIEIHTGCYADAKTDAEQAQELARIAKA-------------------ATFAASLGLKVNAG----------GLTYHNVKAIAAIPEMHENIGHAIIGKDAVAEMKRLMLEARG 243

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.