current user: public




3VM31
Query: 3VM3 Entity 1(prereleased), from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst GSHMTQQRWRLDGQTALITGASAGIGLAIAHELAGFGADLMIVGRDIDMLETARDELLDVYPQMQVHALAADVSDDEDRRQILDWVEDHSDGLHILVNNAGGNVTKAATEYSEDEWRKIFETNLFSAFELSRYAHPLLARHASSSIVNVGSVSGLTHVRSGVVYGMSKAAMHQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLSDPDYYEEVINRTPMRRIGEPEEVAAAVGFLCLPAASYVTGECIAVDGGFLRYGFLast
1 -105.0003VM3 Entity 1(prereleased)  ali  100  1GSHMTQQRWRLDGQTALITGASAGIGLAIAHELAGFGADLMIVGRDIDMLETARDELLDVYPQMQVHALAADVSDDEDRRQILDWVEDHSDGLHILVNNAGGNVTKAATEYSEDEWRKIFETNLFSAFELSRYAHPLLARHASSSIVNVGSVSGLTHVRSGVVYGMSKAAMHQMTRNLAVEWAEDGIRVNAVAPWYIRTRRTSGPLSDPDYYEEVINRTPMRRIGEPEEVAAAVGFLCLPAASYVTGECIAVDGGFLRYGF 261
2 -94.2003cxr_A mol:protein length:291 Dehydrogenase with different specificities  ali model follow..  27  17.QQFSLDQFSLKGKIALVTGASYGIGFAIASAYAKAGATIVFNDINQELVDRGMAAYKAA--GINAHGYVCDVTDEDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLRELHPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAY.. 278
3 -93.5003awd_A mol:protein length:260 Putative polyol dehydrogenase  ali model follow..  36  1GSHMYMEKLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDEAMATKAVEDLRME--GHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICISEKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQKQGVIVAIGSMSGLIVNQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEKPELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTVW.. 260
4 -93.3001xq1_A mol:protein length:266 PUTATIVE TROPINONE REDUCATSE  ali model follow..  39  2AGAEQSQRWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQK--KGFQVTGSVCDASLRPEREKLMQTVSSMFGKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLACEWASDGIRANAVAPAVIATPLAEAVYDD-EFKKVVISRKPLGRFGEPEEVSSLVAFLCMPAASYITGQTICVDGGLTVNGF 260
5 -93.3001ae1_A mol:protein length:273 TROPINONE REDUCTASE-I  ali model follow..  38  10.NCNNEGRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWRE--KGLNVEGSVCDLLSRTERDKLMQTVAHVFGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANGG 272
6 -93.0002ae1_A mol:protein length:260 TROPINONE REDUCTASE-II  ali model follow..  42  1....MAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRS--KGFKVEASVCDLSSRSERQELMNTVANHFGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQDPENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANGF 260
7 -91.9002zat_A mol:protein length:260 Dehydrogenase/reductase SDR family member 4  ali model follow..  31  2ASTGVERRKPLENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQG--EGLSVTGTVCHVGKAEDRERLVAMAVNLHGGVDILVSNAAVNPFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEKRGGGSVLIVSSVGAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLWMDKARKEYMKESLRIRRLGNPEDCAGIVSFLCSEDASYITGETVVVGGGTAS... 258
8 -91.9003lf1_A mol:protein length:265 Short Chain Oxidoreductase Q9HYA2  ali model follow..  28  1.....MKPYDLSEAVAVVTGGSSGIGLATVELLLEAGAAVAFCARDGERLRAAESALRQRFPGARLFASVCDVLDALQVRAFAEACERTLGCASILVNNAGQGRVSTFAETTDEAWSEELQLKFFSVIHPVRAFLPQLESRADAAIVCVNSLLASQPEPHMVATSAARAGVKNLVRSMAFEFAPKGVRVNGILIGLVESGQWRRRFEAREEREARNKQIPLGRLGKPIEAARAILFLASPLSAYTTGSHIDVSGGLSRHA. 265
9 -91.8003uf0_A mol:protein length:273 Short-chain dehydrogenase/reductase SDR  ali model follow..  36  15..QSMTGPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRT-DGVKEVADEIADG--GGSAEAVVADLADLEGAANVAEEL-AATRRVDVLVNNAGIIARAPAEEVSLGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAVVGLTRALASEWAGRGVGVNALAPGYVVTANTAALRADDERAAEITARIPAGRWATPEDMVGPAVFLASDAASYVHGQVLAVDGGWLAS.. 267
10 -91.4002cfc_A mol:protein length:250 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE  ali model follow..  30  2............SRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHA-YADKVLRVRADVADEGDVNAAIAATMEQFGAIDVLVNNAGITGNSVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTA... 249
11 -91.1001vl8_A mol:protein length:267 Gluconate 5-dehydrogenase  ali model follow..  34  4.DKIMKEVFDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRNLEEASEAAQKLTEKY-GVETMAFRCDVSNYEEVKKLLEAVKEKFGKLDTVVNAAGINRRHPAEEFPLDEFRQVIEVNLFGTYYVCREAFSLLRESDNPSIINIGSLTVEETMPNISAYAASKGGVASLTKALAKEWGRYGIRVNVIAPGWYRTKMTEAVFSDPEKLDYMLKRIPLGRTGVPEDLKGVAVFLASEEAKYVTGQIIFVDGGWTAN.. 261
12 -91.1003o4r_A mol:protein length:261 Dehydrogenase/reductase SDR family member 4  ali model follow..  30  3ASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGE--GLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPS... 259
13 -91.1001cyd_A mol:protein length:244 CARBONYL REDUCTASE  ali model follow..  27  3........LNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKE------CPGIEPVCVDLGDWDATEKALGG----IGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGPGSIVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS.. 244
14 -91.0003oic_A mol:protein length:258 Enoyl-[acyl-carrier-protein] reductase [NADPH  ali model follow..  27  2..........EQNKCALVTGSSRGVGKAAAIRLAENGYNIVINARSKKAALETAEEIEKL--GVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSL... 248
15 -90.9001ahh_A mol:protein length:255 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  32  2...FNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQL--GGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPF-DMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVI-TPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQE.. 253
16 -90.9001x1e_A mol:protein length:239 2-deoxy-D-gluconate 3-dehydrogenase  ali model follow..  36  2............ERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQ----------SLGAVPLPTDLEK-DDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPLRQNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLAY.. 239
17 -90.8003gaf_A mol:protein length:256 7-ALPHA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  32  1.SMSYESPFHLNDAVAIVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAAAIRQA--GGKAIGLECNVTDEQHREAVIKAALDQFGKITVLVNNAGGGGPK-PFDMPMSDFEWAFKLNLFSLFRLSQLAAPHMQKAGGGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAIKTDALATVL-TPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVLTVSGGGVQE.. 254
18 -90.8002wdz_A mol:protein length:254 SHORT-CHAIN DEHYDROGENASE/REDUCTASE  ali model follow..  39  4.....RTVFRLDGACAAVTGAGSGIGLEICRAFAASGARLILIDREAAALDRAAQELG----AAVAARIVADVTDAEAMTAAAAEA-EAVAPVSILVNSAGIARLHDALETDDATWRQVMAVNVDGMFWASRAFGRAMVARGAGAIVNLGSMSGTIVNRPQSSYMASKGAVHQLTRALAAEWAGRGVRVNALAPGYVATEMTLKMRERPELFETWLDMTPMGRCGEPSEIAAAALFLASPAASYVTGAILAVDGGYTVW.. 254
19 -90.7002ew8_A mol:protein length:249 (S)-1-Phenylethanol dehydrogenase  ali model follow..  31  4.........RLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPA--PEAEAAIRNL--GRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTEASALSAMFDVLPNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH.. 249
20 -90.6001pr9_A mol:protein length:244 L-XYLULOSE REDUCTASE  ali model follow..  29  3........LFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRE------CPGIEPVCVDLGDWEATERALGS----VGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWA... 243
21 -90.3002d1y_A mol:protein length:256 hypothetical protein TT0321  ali model follow..  31  1.......MGLFAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVA--------EAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIDPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTA... 247
22 -90.2004dqx_A mol:protein length:277 Probable oxidoreductase protein  ali model follow..  28  10.ENLYFQSMDLNQRVCIVTGGGSGIGRATAELFAKNGAYVVVADVNEDAAVRVANEI-----GSKAFGVRVDVSSAKDAESMVEKTTAKWGRVDVLVNNAGFGTTGNVVTIPEETWDRIMSVNVKGIFLCSKYVIPVMRRNGGGSIINTTSYTATSAIADRTAYVASKGAISSLTRAMAMDHAKEGIRVNAVAPGTIDSPYFTKIFDPAKLRSDFNARAVMDRMGTAEEIAEAMLFLASDRSRFATGSILTVDGGSSI... 265
23 -90.2003rro_A mol:protein length:251 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  35  1.SNAMSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYL-----GDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKAL--NDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM... 250
24 -90.2002yz7_A mol:protein length:260 D-3-hydroxybutyrate dehydrogenase  ali model follow..  31  2..........LKGKKAVVTGSTSGIGLAMATELAKAGADVVINGFGQPEDIERERSTLESKFGVKAYYLNADLSDAQATRDFIAKAAEALGGLDILVNNAGIQHTAPIEEFPVDKWNAIIALNLSAVFHGTAAALPIMQKQGWGRIINIASAHGLVASVNKSAYVAAKHGVVGLTKVTALENAGKGITCNAICPGWVRTPLVEKQIEEAAARELLAEKQPSLQFVTPEQLGGAAVFLSSAAADQMTGTTLSLDGGWTA... 259
25 -90.1003aus_A mol:protein length:269 Glucose 1-dehydrogenase 4  ali model follow..  32  6.........DLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYNNEEEALDAKKEVEEA--GGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKY.. 255
26 -90.1001rwb_A mol:protein length:261 Glucose 1-dehydrogenase  ali model follow..  32  4.........DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKV--GGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTKTLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTLY.. 253
27 -90.0001g6k_A mol:protein length:261 GLUCOSE 1-DEHYDROGENASE  ali model follow..  32  4.........DLEGKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRKEDEANSVLEEIKKV--GGEAIAVKGDVTVESDVINLVQSAIKEFGKLDVMINNAGLANPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPEQRADVESMIPMGYIGEPEEIAAVAAWLASSEASYVTGITLFADGGMTQY.. 253
28 -90.0003AY6 Entity 1(prereleased)  ali follow..  32  6.........DLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYNNEEEALDAKKEVEEA--GGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKY.. 255
29 -89.9001i01_A mol:protein length:244 BETA-KETOACYL [ACP] REDUCTASE  ali model follow..  33  1........MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL-----GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRAL--SDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM... 243
30 -89.9003svt_A mol:protein length:281 Short-chain type dehydrogenase/reductase  ali model follow..  29  6.......QLSFQDRTYLVTGGGSGIGKGVAAGLVAAGASVMIVGRNPDKLAGAVQELEALGNGGAIRYEPTDITNEDETARAVDAVTAWHGRLHGVVHCAGGSENGPITQVDSEAWRRTVDLNVNGTMYVLKHAAREMVRGGGGSFVGISSIAASNTHRWFGAYGVTKSAVDHLMQLAADELGASWVRVNSIRPGLIRTDLVAAITESAELSSDYAMCTPLPRQGEVEDVANMAMFLLSDAASFVTGQVINVDGGQMLRR. 260
31 -89.8003ai1_A mol:protein length:263 NADPH-sorbose reductase  ali model follow..  30  3........MGISGKVAVITGSSSGIGLAIAEGFAKEGAHIVLVARQVDRLHEAARSLKEKF-GVRVLEVAVDVATPEGVDAVVESVRSSFGGADILVNNAGTGSNETIMEAADEKWQFYWELHVMAAVRLARGLVPGMRARGGGAIIHNASICAVQPLWYEPIYNVTKAALMMFSKTLATEVIKDNIRVNCINPGLILTPDWIKTAKKGYLQSVADEHAPIKRFASPEELANFFVFLCSERATYSVGSAYFVDGGMLK... 261
32 -89.7001wmb_A mol:protein length:260 D(-)-3-hydroxybutyrate dehydrogenase  ali model follow..  29  2..........LKGKVAVVTGSTSGIGLGIATALAAQGADIVLNGFGDAAEIEKVRAGLAAQHGVKVLYDGADLSKGEAVRGLVDNAVRQMGRIDILVNNAGIQHTALIEDFPTEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVASANKSAYVAAKHGVVGFTKVTALETAGQGITANAICPGWVRTPLVEKQISETAARELLSEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTTVSVDGGWTA... 259
33 -89.7003ak4_A mol:protein length:263 NADH-dependent quinuclidinone reductase  ali model follow..  30  1GSHMA-GIFDLSGRKAIVTGGSKGIGAAIARALDKAGATVAIADLDVMAAQAVVAGL-----ENGGFAVEVDVTKRASVDAAMQKAIDALGGFDLLCANAGVSTMRPAVDITDEEWDFNFDVNARGVFLANQIACRHFLASNTGVIVNTASLAAKVGAPLLAHYSASKFAVFGWTQALAREMAPKNIRVNCVCPGFVKTAMQEREIIPEAVRAEYVSLTPLGRIEEPEDVADVVVFLASDAARFMTGQGINVTGGVRMD.. 263
34 -89.6003ndr_A mol:protein length:247 3-oxoacyl-(Acyl-carrier protein) reductase  ali model follow..  29  3.........RLAGKTALVTGAAQGIGKAIAARLAADGATVIVSDINAEGAKAAAASI-----GKKARAIAADISDPGSVKALFAEIQALTGGIDILVNNASIVPFVAWDDVDLDHWRKIIDVNLTGTFIVTRAGTDQMRAAGAGRVISIASNTFFAGTPNMAAYVAAKGGVIGFTRALATELGKYNITANAVTPGLIESDGVKAS-PHNEAFGFVEMLQAMKGKGQPEHIADVVSFLASDDARWITGQTLNVDAGMVRH.. 247
35 -89.6001k2w_A mol:protein length:256 SORBITOL DEHYDROGENASE  ali model follow..  26  1........MRLDGKTALITGSARGIGRAFAEAYVREGARVAIADINLEAARATAAEI-----GPAACAIALDVTDQASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGGGKIINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWMS.. 256
36 -89.5002q2q_A mol:protein length:255 Beta-D-hydroxybutyrate dehydrogenase  ali model follow..  29  1.........TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDP--APALAEIARH--GVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ.. 255
37 -89.5003lyl_A mol:protein length:247 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  31  1........MSLNEKVALVTGASRGIGFEVAHALASKGATVVGTATSQASAEKFENSMKEK--GFKARGLVLNISDIESIQNFFAEIKAENLAIDILVNNAGITRDNLMMRMSEDEWQSVINTNLSSIFRMSKECVRGMMKKRWGRIISIGSVVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDMTDKL--TDEQKSFIATKIPSGQIGEPKDIAAAVAFLASEEAKYITGQTLHVNGGMYM... 246
38 -89.4003pk0_A mol:protein length:262 Short-chain dehydrogenase/reductase SDR  ali model follow..  26  4......SMFDLQGRSVVVTGGTKGIGRGIATVFARAGANVAVAGRSTADIDACVADLDQLG-SGKVIGVQTDVSDRAQCDALAGRAVEEFGGIDVVCANAGVFPDAPLATMTPEQLNGIFAVNVNGTFYAVQACLDALIASGSGRVVLTSSITGITGYPGWSHYGATKAAQLGFMRTAAIELAPHKITVNAIMPGNIMTEGLLEN--GEEYIASMARSIPAGALGTPEDIGHLAAFLATKEAGYITGQAIAVDGGQVL... 253
39 -89.3001zem_A mol:protein length:262 xylitol dehydrogenase  ali model follow..  26  4.........KFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREK--GVEARSYVCDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVEKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG...... 262
40 -89.3003uxy_A mol:protein length:266 Short-chain dehydrogenase/reductase SDR  ali model follow..  30  15.....QSMQGFEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAGIAADL-------------HLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAV... 259
41 -89.1003enn_A mol:protein length:249 GLUCOSE/RIBITOL DEHYDROGENASE  ali model follow..  31  4......SMFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAEL-----GERIFVFPANLSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTRELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCIAPGFIESAMTGKL--NEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNGGMAM... 248
42 -89.0003r1i_A mol:protein length:276 Short-chain type dehydrogenase/reductase  ali model follow..  32  18....VLDLFDLSGKRALITGASTGIGKKVALAYAEAGAQVAVAARHSDALQVVADEIAGV--GGKALPIRCDVTQPDQVRGMLDQMTGELGGIDIAVCNAGIVSVQAMLDMPLEEFQRIQDTNVTGVFLTAQAAARAMVDQGGGTIITTASMSGHIINIPQSHYCTSKAAVVHLTKAMAVELAPHQIRVNSVSPGYIRTELVEPL---ADYHALWEPKIPLGRMGRPEELTGLYLYLASAASSYMTGSDIVIDGGYTC... 269
43 -89.0002fwm_X mol:protein length:250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogena  ali model follow..  27  1......GHMDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFTQ------------EQYPFATEVMDVADAAQVAQVCQRLLAETERLDALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDFGEQFKLGIPLGKIARPQEIANTILFLASDLASHITLQDIVVDGGSTL... 248
44 -88.9002b4q_A mol:protein length:276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl-car  ali model follow..  35  13..SHMHPYFSLAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYG---DCQAIPADLSSEAGARRLAQALGELSARLDILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRENPARVINIGSVAGISAMGEQAAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIANDPQALEADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFHL... 270
45 -88.9003gvc_A mol:protein length:277 Probable short-chain type dehydrogenase/reduc  ali model follow..  28  15....SMNHPDLAGKVAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAATKI-----GCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVANAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGGTGAYGMSKAGIIQLSRITAAELRSSGIRSNTLLPAFVDTPMQQTAMAMGAGGARSMIARLQGRMAAPEEMAGIVVFLLSDDASMITGTTQIADGGTIA... 268
46 -88.6001iy8_A mol:protein length:267 LEVODIONE REDUCTASE  ali model follow..  29  2.TATSSPTTRFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSA... 265
47 -88.3003v2h_A mol:protein length:281 D-beta-hydroxybutyrate dehydrogenase  ali model follow..  27  14.......FQSMMTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPADMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTPLVEKQIPDQVINEVMLKGQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGGWTAQ.. 275
48 -88.1001hdc_A mol:protein length:254 3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE  ali model follow..  31  2.........DLSGKTVIITGGARGLGAEAARQAVAAGARVVLADVLDEEGAATAREL-----GDAARYQHLDVTIEEDWQRVVAYAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVEINLTGVFIGMKTVIPAMKDAGGGSIVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPMTAET--GIRQGEGNYPNTPMGRVGEPGEIAGAVVKLLSDTSSYVTGAELAVDGGWTT... 244
49 -88.1003sju_A mol:protein length:279 Keto reductase  ali model follow..  30  16..........SRPQTAFVTGVSSGIGLAVARTLAARGIAVYGCARDAKNVSAAVDGLRAA--GHDVDGSSCDVTSTDEVHAAVAAAVERFGPIGILVNSAGRNGGGETADLDDALWADVLDTNLTGVFRVTREVLRAMREAGWGRIVNIASTGGKQGVMYAAPYTASKHGVVGFTKSVGFELAKTGITVNAVCPGYVETPMAERVREEQEVHERFNAKIPLGRYSTPEEVAGLVGYLVTDAAASITAQALNVCGGLGNY.. 273
50 -87.8003grp_A mol:protein length:266 3-oxoacyl-(Acyl carrierprotein) reductase  ali model follow..  30  15......SMFKLTGRKALVTGATGGIGEAIARCFHAQGAIVGLHGTREDKLKEIAADL-----GKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVNNAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVGVVGNPGQTNYCAAKAGLIGFSKALAQEIASRNITVNCIAPGFIKSAMTDKL--NEKQKEAIMAMIPMKRMGIGEEIAFATVYLASDEAAYLTGQTLHINGGMAM... 259
51 -87.5003o38_A mol:protein length:266 Short chain dehydrogenase  ali model follow..  29  20..........LKGKVVLVTAAATGIGSTTARRALLEGADVVISDYHERRLGETRDQLADLGLG-RVEAVVCDVTSTEAVDALITQTVEKAGRLDVLVNNAGLGGQTPVVDMTDEEWDRVLNVTLTSVMRATRAALRYFRGVDGGVIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAVEFGVRINAVSPSIARHKFLEKTS-SSELLDRLASDEAFGRAAEPWEVAATIAFLASDYSSYMTGEVVSVSSQRA.... 266
52 -87.5002p68_A mol:protein length:248 3-oxoacyl-[acyl-carrier-protein] reductase  ali model follow..  33  2.......EIKLQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKY-GVKAHGVEMNLLSEESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDMTAVL--SEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGGMF.... 248
53 -87.4001w4z_A mol:protein length:281 KETOACYL REDUCTASE  ali model follow..  29  13.....SHMATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREA--GVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGNY.. 275
54 -87.3004DBZ Entity 1(prereleased)  ali follow..  28  13.....SHMATQDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREA--GVEADGRTCDVRSVPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGGKQGLVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGNY.. 275
55 -87.3001uls_A mol:protein length:245 putative 3-oxoacyl-acyl carrier protein reduc  ali model follow..  31  1........MRLKDKAVLITGAAHGIGRATLELFAKEGARLVACDIEEGPLREAAEAV-------GAHPVVMDVADPASVERGFAEALAHLGRLDGVVHYAGITRDNFHWKMPLEDWELVLRVNLTGSFLVAKAASEAMREKNPGSIVLTASRVYL-GNLGQANYAASMAGVVGLTRTLALELGRWGIRVNTLAPGFIETRMTAKV--PEKVREKAIAATPLGRAGKPLEVAYAALFLLSDESSFITGQVLFVDGGRTI... 240
56 -87.0003ftp_A mol:protein length:270 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  34  17.......DKTLDKQVAIVTGASRGIGRAIALELARRGAMVIGTATTEAGAEGIGAAFKQA--GLEGRGAVLNVNDATAVDALVESTLKEFGALNVLVNNAGITQDQLAMRMKDDEWDAVIDTNLKAVFRLSRAVLRPMMKARGGRIVNITSVVGSAGNPGQVNYAAAKAGVAGMTRALAREIGSRGITVNCVAPGFIDTDMTKGL--PQEQQTALKTQIPLGRLGSPEDIAHAVAFLASPQAGYITGTTLHVNGGMFM... 263
57 -87.0001geg_A mol:protein length:256 ACETOIN REDUCTASE  ali model follow..  26  2............KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQA--GGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN.. 256
58 -86.9003n74_A mol:protein length:261 3-ketoacyl-(acyl-carrier-protein) reductase  ali model follow..  29  4.......SMSLEGKVALITGAGSGFGEGMAKRFAKGGAKVVIVDRDKAGAERVAGEI-----GDAALAVAADISKEADVDAAVEAALSKFGKVDILVNNAGIGHKPQNAEVEPEEFDRIVGVNVRGVYLMTSKLIPHFKENGACVILNVASTGAGRPRPNLAWYNATKGWVVSVTKALAIELAPAKIRVVALNPVAGETPLLTTFMDSEEIRKKFRDSIPMGRLLKPDDLAEAAAFLCSPQASMITGVALDVDGGRSIGG. 258
59 -86.7001nff_A mol:protein length:260 Putative oxidoreductase Rv2002  ali model follow..  29  4.........RLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAEL-----ADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPED-------IFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVA... 240
60 -86.6002cf2_E mol:protein length:226 FATTY ACID SYNTHASE, KR DOMAIN  ali model follow..  33  1........MNFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYL-----GANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIG---------GQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETSDDQ--------RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM..... 226
61 -86.5001nxq_A mol:protein length:251 R-alcohol dehydrogenase  ali model follow..  33  3.........RLDGKVAIITGGTLGIGLAIATKFVEEGAKVMITGRHSDVGEKAAKSVGT---PDQIQFFQHDSSDEDGWTKLFDATEKAFGPVSTLVNNAGIAVNKSVEETTTAEWRKLLAVNLDGVFFGTRLGIQRMKNKGLGSIINMSSIEGFVGDPSLGAYNASKGAVRIMSKSAALDCALKDVRVNTVHPGYIKTPLVDDLP-GAEEAMSQRTKTPMGHIGEPNDIAYICVYLASNESKFATGSEFVVDGGYTA... 250
62 -86.5002hq1_A mol:protein length:247 Glucose/ribitol dehydrogenase  ali model follow..  33  1........MQLKGKTAIVTGSSRGLGKAIAWKLGNMGANIVLNGSASTSLDATAEEFKAA--GINVVVAKGDVKNPEDVENMVKTAMDAFGRIDILVNNAGITRDTLMLKMSEKDWDDVLNTNLKSAYLCTKAVSKIMLKQKSGKIINITSIAGIIGNAGQANYAASKAGLIGFTKSIAKEFAAKGIYCNAVAPGIIKTDMTDVL--PDKVKEMYLNNIPLKRFGTPEEVANVVGFLASDDSNYITGQVINIDGGLVM... 247
63 -86.4003ucx_A mol:protein length:264 Short chain dehydrogenase  ali model follow..  26  9..........LTDKVVVISGVGPALGTTLARRCAEQGADLVLAARTVERLEDVAKQVTDT--GRRALSVGTDITDDAQVAHLVDETMKAYGRVDVVINNAFVPSMKPFANTTFEHMRDAIELTVFGALRLIQGFTPAL-EESKGAVVNVNSMVVRHSQAKYGAYKMAKSALLAMSQTLATELGEKGIRVNSVLPGYIWGGTLKSYFEHEDIYNAAAAGSDLKRLPTEDEVASAILFMASDLASGITGQALDVNCGEYK... 263
64 -86.4002uvd_A mol:protein length:246 3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE  ali model follow..  33  2..........LKGKVALVTGASRGIGRAIAIDLAKQGANVVVNAGNEQKANEVVDEIKKL--GSDAIAVRADVANAEDVTNMVKQTVDVFGQVDILVNNAGVTKDNLLMRMKEEEWDTVINTNLKGVFLCTKAVSRFMMRQRHGRIVNIASVVGVTGNPGQANYVAAKAGVIGLTKTSAKELASRNITVNAIAPGFIATDMTDVL--DENIKAEMLKLIPAAQFGEAQDIANAVTFFASDQSKYITGQTLNVDGGMVM... 246
65 -86.3003i4f_A mol:protein length:264 3-oxoacyl-[acyl-carrier protein] reductase  ali model follow..  24  3........LGRFVRHALITAGTKGLGKQVTEKLLAKGYSVTVTYHSDTTAMETMKE-TYKDVEERLQFVQADVTKKEDLHKIVEEAMSHFGKIDFLINNAGVFERKKLVDYEEDEWNEMIQGNLTAVFHLLKLVVPVMRKQNFGRIINYGGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEAEYGITANMVCPGDIIGEMKEAT--IQEARQLKEHNTPIGRSGTGEDIARTISFLCEDDSDMITGTIIEVTGAVDV... 253
66 -86.3003sj7_A mol:protein length:252 3-oxoacyl-(Acyl-carrier-protein) reductase  ali model follow..  31  2..........SMTKSALVTGASRGIGRSIALQLAEEGYNVAVNAGSKEKAEAVVEEIKAK--GVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDAL--SDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM... 246
67 -86.2003a28_C mol:protein length:258 L-2.3-butanediol dehydrogenase  ali model follow..  27  2............SKVAMVTGGAQGIGRGISEKLAADGFDIAVADLPQQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLGGFDVLVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAASRKFDELGKGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQAAAQELAPKGHTVNAYAPGIVGTGMWEQIDAEGENFKEYSSSIALGRPSVPEDVAGLVSFLASENSNYVTGQVMLVDGGMLYN.. 258
68 -86.0001pwx_A mol:protein length:254 halohydrin dehalogenase  ali model follow..  17  2.............STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDEL--------EAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIE. 247
69 -86.0003gk3_A mol:protein length:269 Acetoacetyl-CoA reductase  ali model follow..  26  8.AQTQGPGSMQAKRVAFVTGGMGGLGAAISRRLHDAGMAVAVSHSERNDHVSTWLM-HERDAGRDFKAYAVDVADFESCERCAEKVLADFGKVDVLINNAGITRDATFMKMTKGDWDAVMRTDLDAMFNVTKQFIAGMVERRFGRIVNIGSVNGSRGAFGQANYASAKAGIHGFTKTLALETAKRGITVNTVSPGYLATAMVEAV-PQDVLEAKILPQIPVGRLGRPDEVAALIAFLCSDDAGFVTGADLAINGGMHM... 262
70 -86.0001h5q_A mol:protein length:265 NADP-DEPENDENT MANNITOL DEHYDROGENASE  ali model follow..  29  1GSHMAGFTISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEF-GVKTKAYQCDVSNTDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLKQQKGSIVVTSSMSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHM--DKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLIW.. 265
71 -85.6003v8b_A mol:protein length:283 Putative dehydrogenase, possibly 3-oxoacyl-[a  ali model follow..  30  15.....QSMMNQPSPVALITGAGSGIGRATALALAADGVTVGALGRTRTEVEEVADEIVGA--GGQAIALEADVSDELQMRNAVRDLVLKFGHLDIVVANAGINGVAPIDDLKPFEWDETIAVNLRGTFLTLHLTVPYLKQRGGGAIVVVSSINGTFTTPGATAYTATKAAQVAIVQQLALELGKHHIRVNAVCPGAIETNISDNTKLRHEEETAIQVPITDGQPGRSEDVAELIRFLVSERARHVTGSPVWIDGGQGL... 275
72 -85.6002zk7_A mol:protein length:257 Glucose 1-dehydrogenase related protein  ali model follow..  30  6.........DLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPG-------------EAKYDHIECDVTNPDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYA-PLLRCNAVCPATIDTPLVRKAAELEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIRA. 251
73 -85.4002ag5_A mol:protein length:246 dehydrogenase/reductase (SDR family) member 6  ali model follow..  24  1.......MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYP-------GIQTRVLDVTKKKQIDQFANE----VERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVASVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERINPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL... 245
74 -85.2002a4k_A mol:protein length:263 3-oxoacyl-[acyl carrier protein] reductase  ali model follow..  34  1.......MGRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAAL-----EAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALSWNLPLEAWEKVLRVNLTGSFLVARKAGEVLEE--GGSLVLTGSVAGL-GAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGL--PPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIVG. 243
75 -85.1003ezl_A mol:protein length:256 Acetoacetyl-CoA reductase  ali model follow..  26  3........MVMSQRIAYVTGGMGGIGTSICQRLHKDGFRVVAGGPNSPRRVKWLEDQKAL--GFDFYASEGNVGDWDSTKQAFDKVKAEVGEIDVLVNNAGITRDVVFRKMTREDWQAVIDTNLTSLFNVTKQVIDGMVERGWGRIINISSVNGQKGQFGQTNYSTAKAGIHGFTMSLAQEVATKGVTVNTVSPGYIGTDMVKAI--RPDVLEKIVATIPVRRLGSPDEIGSIVAWLASEESGFSTGADFSLNGGLHM... 249

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.