current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

3R871
Query: 3R87 Entity 1(prereleased), from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GSMSKIYHHPVQIYYEDTDHSGVVYHPNFLKYFERAREHVIDSDKLATLWNDHGLGFAVYKANMIFQDGVEFAEICDIRTSFTLDGKYKTLWRQEVWRPGASRAAVIGDIEMVCLDKEKRLQPVPADILASMMADLast
1 -92.6003R87 Entity 1(prereleased)  ali  100  1GSMSKIYHHPVQIYYEDTDHSGVVYHPNFLKYFERAREHVIDSDKLATLWNDHGLGFAVYKANMIFQDGVEFAEICDIRTSFTLDGKYKTLWRQEVWRPGASRAAVIGDIEMVCLDKEKRLQPVPADILASMMAD 135
2 -77.3003hm0_A mol:protein length:167 Probable Thioesterase  ali model follow..  19  25SHTNAFHDFQARVYVADTDFSGVVYHARYLEFFERGRSEFLRDTGFNNTVEGEKLFFVVRHMEINFSRPAQIDNLLTIKTRISRLQGARFFMEQYILH--GESMLVTAKVEIALINEEGKPRRLPKELFSTIVV. 161
3 -76.6001s5u_A mol:protein length:138 Protein ybgC  ali model follow..  22  5...TTLFRWPVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHFSQALMAERVAFVVRKMTVEYYAPARLDDMLEIQTEITSMRGTSLVFTQRIVN-AENTLLNEAEVLVVCVDPLMKPRALPKSIVAEFKQ. 136
4 -76.4002xem_A mol:protein length:150 DYNE7  ali model follow..  17  1..MPDSYVHRHVVTFDETNLVGNVYFAHYLHWQGHCREHFLADHAPGVAALADGLALVTVDCHADFYAEGSAFDEVEVRMMLDRLDGHRIAMSFDYVRPGPPTLLAQGRQTVACMRRAGEPVEVPAELRRALSR. 138
5 -76.4002w3x_A mol:protein length:147 CALE7  ali model follow..  18  2.SMPRYYEYRHVVGFEETNLVGNVYYVNYLRWQGRCREMFLYEHAPEIDELRADLKLFTLKAECEFFAELAPFDRLAVRMRLVELTQTQMELGFDYLRGGDDLLVARGRQRIACMRGPNEPVRVPAGLVRAFAP. 139
6 -76.1001bvq_A mol:protein length:141 PROTEIN (4-HYDROXYBENZOYL COA THIOESTERASE)  ali model follow..  19  1..MARSITMQQRIEFGDCDPAGIVWYPNYHRWLDAASRNYFIKCGLPPVVERGIVGTPIVSCNASFVCTASYDDVLTIETCIKEWRRKSFVQRHSVSRTTDVQLVMRADEIRVFAMNDGRAIEVPADYIELCS.. 141
7 -75.1002pzh_A mol:protein length:135 Hypothetical protein HP_0496  ali model follow..  24  2.......HMRCRVYYEDTDSEGVVYHANYLKYCERARSEFFFKQNVLP--ENEEGVFVIRSIKADFFTPASLGQVLEIRTQIKELRKVFVVLFQEIYCIQNPFKVFASEIKFGFVNRSYSPIAIPKLFKELLNA. 134
8 -73.7001z54_A mol:protein length:132 probable thioesterase  ali model follow..  23  2.....ESVTRIKVRYAETDQMGVVHHSVYAVYLEAARVDFLERAGLPYRVEARGVFFPVVELGLTFRAPARFGEVVEVRTRLAELSSRALLFRYRVER--EGVLLAEGFTRHLCQV-GERAARIPEDIYRALSV. 128
9 -73.4002gf6_A mol:protein length:135 Conserved hypothetical protein  ali model follow..  12  1GMENIEYVFEDVVRIYDTDAQGIAHYAAYYRFFTNTIEKFIKEKVGIPPIVNENLWFVIAESHAIYHRPVKLGDKLTVLLNPKILSNKTIKFEFKVLK--DGELTTEGYVIQIAINPKWKSTEMPKEIMDKLSIK 135
10 -72.8002egi_A mol:protein length:128 Hypothetical protein aq_1494  ali model follow..  15  2.....PFIYRRRVQFYETDAQGIVHHSNYFRYFEEARGEFLRSKGFPYKMRDMGLEVVLLNAYCEYKKPLFYDDVFEVHLNLEELSRFTFTFSYIVFK--EDIAVAKANTKHCMVK-NGKIVSIPKEVLEVLKD. 128
11 -72.2001njk_A mol:protein length:156 Hypothetical protein ybaW  ali model follow..  12  13..FQGHMQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMTAHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALITFVCIDKTQKALALEGELREKLEQ. 145
12 -70.3002hx5_A mol:protein length:152 Hypothetical protein  ali model follow..  11  3.NPENWLLLRRVVRFGDTDAAGVMHFHQLFRWCHESWEESLESYGLNPAEVTPEVALPIIHCQADFRRPIHTGDALAMELRPERLNPNSFQVHFEFRC--EEQIAAHALIRHLAINAQRHRCALPEGIDRWLEA. 143
13 -66.1003ck1_A mol:protein length:150 Putative thioesterase  ali model follow..  14  1.GMTAVFRNTVLVRFKHCDAAGIVFYPRYFEMLNDFIEDWFQALDWPFDHGAGQAGVPTADLHCRFVAPSRLGETLTRELRVVKLGQSSFTVQVRFMG-PDSGLRLEVTQRLVCVDTDKAPRPLPDPVRQAMAT. 136
14 -62.8002oaf_A mol:protein length:151 Thioesterase superfamily  ali model follow..  17  14...DSAFVHDVRVTWGDCDPAKIAYTGHLPRFALEAIDAWWSEYHGPHLELDTNVGTPFVRLEMDFKSPVTPRHILKCHTWPTRLGTKSITFRVDGVQ--DGVTCFVGAFTCVFTIADQKSQPAPDHLRALIEP. 147
15 -60.7002o6b_A mol:protein length:149 THIOESTERASE  ali model follow..  14  16......HFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIERGGL-DIQGGEVIGLVVSSSCDYFAPVAFPQRIEMGLRVARLGNSSVQYELALFLEGQREACAAGRFVHVFVERSSRPVAIPQELRDALAA. 143
16 -60.1002oiw_A mol:protein length:136 putative 4-hydroxybenzoyl-CoA thioesterase  ali model follow..  12  2...NAMFTTVITPRVSETDGVGHINNTTVPVWFEAGRHEIFKLFTPD--LSFKRWRMVIIRMEVDYVNQMYYGQDVTVYTGIERIGNTSLTIYEEIHQ--NGVVCAKGRSVYVNFNDTGRPEPIPDDIRVKLRE. 129
17 -59.9003qy3_A mol:protein length:158 Thioesterase  ali model follow..  15  18ADRQLLHTAHIPVRWGDMDSYGHVNNTLYFQYLEEARVAWFETLGID--LEGAAEGPVVLQSLHTYLKPVVHPATVVVELYAGRLGTSSLVLEHRLHTEDPQGTYGEGHCKLVWVRAENRSTPVPDSIRAAIAGS 152
18 -59.7002fuj_A mol:protein length:137 conserved hypothetical protein  ali model follow..  12  5SEHKILARVPISVRWRDMDSMGHVNNAKYISYLEEARVRWMLGVEGV--AMTDRIAPVVAATNVNYKRPLVWPNDILVELFVERLGSSSVTIGHRILDKDEGVLYSDGNVVVVWIDQTGKSASLPDAVRAASS.. 137
19 -57.9002nuj_A mol:protein length:163 Thioesterase superfamily  ali model follow..  14  27......FGLADRVRFGELDAIGHVNHTAYLRWYESFRLPFLKARHVT-DYGPTSPRLVLKQVHCTYLAEMGMGEDYVITGRVSNFRTTSFTMEFACWRLDAVECTSEGSAVVVLLNDGSGRYPIPEAGRASFVT. 155
20 -57.9002hlj_A mol:protein length:157 Hypothetical protein  ali model follow..  12  1.GMPALITYRTTVQEDWVDYNGHLRDAFYLLIFSYATDALMDRIGLDADRGQSGNSLFTLEAHINYLHEVKLGTEVWVQTQILGFDRKRLHVYHSLHRAGFDEVLAASEQMLLHVDAGPQSAPFGHTTVCRLNH. 135
21 -57.1002cye_A mol:protein length:133 Putative thioesterase  ali model follow..  20  6......VRVRVDVRFRDLDPLGHVNNAVFLSYMELARIRYFQRISPDWL---EEGHFVVARMEVDYLRPILLGDEVFVGVRTVGLGRSSLRMEHLVTA--NGESAAKGLGVLVWLE-GGRPAPLPEAIRERIRA. 127
22 -22.5002own_A mol:protein length:262 Putative Oleoyl-[acyl-carrier protein] thioes  ali model follow..  15  6GANASLYSEQHRITYYECDRTGRATLTTLIDIAVLASEDQSDALGLTTEVQSHGVGWVVTQYAIDITRMPRQDEVVTIAVRGSAYNPYFAYREFWIR-DADGQQLAYITSIWVMMSTTRRIVKILPELVAPYQSE 141
23 -22.0002ess_A mol:protein length:248 acyl-ACP thioesterase  ali model follow..  3SEENKIGTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFHASDRGFGIALNEDNYTWVLSRLAIELDEMPYQYEKFSVQTWVENVYRLFTDRNFAVI-DKDGKKIGYARSVWAMINNTRKPADLLALHGGSIVDY 138
24 -20.7002eis_A mol:protein length:133 Hypothetical protein TTHB207  ali model follow..  17  10............VFPGETNHYGTLFGGTVLAWMDQA-------AFVAATRHARKKVVTVHADAVDFKRPVPLGAIVELVARLKEVGRTSMRVEVEMWVEPEAYLAARGGFVLVAVDERGRPSPVPPLEGGE.... 126
25 -20.7003d6l_A mol:protein length:137 Putative hydrolase  ali model follow..  11  13............AMPSDTNPAGNIFGGWILSQIDLA--------AIAARELSPERVVTISMDKVVFKEPVFIGDIISCYSKVVNVGNTSISVEVEVTAQRSCINVTSALVTYVSVTRDGKKNPISEELKRIHGF. 134
26 -20.1001yli_A mol:protein length:153 Putative acyl-CoA thioester hydrolase HI0827  ali model follow..  13  22............AMPSDTNANGDIFGGWIMSQMDMG--------AILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQCLKVGRSSIKIKVEVWVKKERYCVTDAVFTFVAVDNNGRSRTIPRENNQELEK. 143
27 -19.8001y7u_A mol:protein length:174 Acyl-CoA hydrolase  ali model follow..  13  26............VFPTDLNDHNTLFGGKILSEMDMV-------ASISASRHSRKECVTASMDWVDFLHPVRSSDCVSYESFVIWTGRTSMEVFVKVVSEYEKRIAATSFVTFVALSKENNPVPVPRVIPD..... 140
28 -19.5001vpm_A mol:protein length:169 acyl-CoA hydrolase  ali model follow..  14  24............VLPPDTNHLGTIFGGKVLAYIDEI-------AALTAMKHANSAVVTASIDSVDFKSSATVGDALELEGFVTHTGRTSMEVYVRVHSNNERTLTTESFLTMVAVDESGKPKPVPQVEPQ..... 138
29 -19.4002cy9_A mol:protein length:140 Thioesterase superfamily member 2  ali model follow..  39.......ICEMKVEEQHTNKLGTLHGGLTATLVDSI-------STMALMCTERGAPGVSVDMNITYMSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGRHTKHLGN................... 140
30 -19.1002f0x_A mol:protein length:148 Thioesterase superfamily member 2  ali model follow..  12  39.......ICEMKVEEEHTNAIGTLHGGLTATLVDNI-------STMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGNLE................. 142
31 -18.8002v1o_A mol:protein length:151 CYTOSOLIC ACYL COENZYME A THIOESTER HYDROLASE  ali model follow..  14  6............MRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVE-RTDFLSPMCIGEVAHVSAEITYTSKHSVEVQVHVMSENTKKLTNKATLWYVPLKNVDKVLEVPPIVYL..... 128
32 -18.6002q2b_A mol:protein length:179 Cytosolic acyl coenzyme A thioester hydrolase  ali model follow..  13  33............VGPSDCTLHGFVHGGVTMKLMDEV-------AGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPKRYRAASAFFTYVSLNQEGKPMPVPQLVPE..... 149
33 -18.3002h4u_A mol:protein length:145 Thioesterase superfamily member 2  ali model follow..  11  38.......ICEMKVEEEHTNAIGTLHGGLTATLVDNI-------STMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN................... 139
34 -18.1002qq2_A mol:protein length:193 Cytosolic acyl coenzyme A thioester hydrolase  ali model follow..  14  43............VGPSDCTLHGFVHGGVTMKLMDEV-------AGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPKRYRAASAFFTYVSLSQEGRSLPVPQLVPE..... 159
35 -17.0002qwz_A mol:protein length:159 Phenylacetic acid degradation-related protein  ali model follow..  49.......TMRLNVQERHLRPGGTVSGPSMFALADVSVYALVLA------HLGREALAVTTNASLDFMRKPESGRDLLGQARLLKLGRTLAVGDILLFSEGMEAPVARSTMTYSIPPKR................. 153
36 -16.5002prx_A mol:protein length:160 Thioesterase superfamily protein  ali model follow..  10  51.................TAIPGFVYGGLIASLIDCHGTGSARALEQAGEQLDEPPRFVTAALNIDYLAPTPMGVELELVGEIKEVKPRKVVVEIALS--ADGKLCARGHMVAVKMPET................. 154
37 -16.3003f1t_A mol:protein length:148 uncharacterized protein Q9I3C8_PSEAE  ali model follow..  36.....TLRLPYSQAIIGNPESGVVHGGAITTLMDTTCGISTVC------VLPDFEICPTLDLRIDYMHPAEPHKDVYGFAECYRVTPNVIFTRGFAYQDDPGQPIAHVVGAFMRMGLE................. 142
38 -15.7002gvh_A mol:protein length:288 AGR_L_2016p  ali model follow..  12  29............VFPGDTNHHGTLFGGTGLALMDRV-------AFIAATRFGRTPFVTASCERIDFRQPARIGHIVEFTARPVKAGRRSLTVEVEMVAETQQHTCTRGIFHMVAIPEGEDAASYVL......... 139
39 -15.3002f3x_A mol:protein length:157 Transcription factor fapR  ali model follow..  14  62.................FSRNQIARGHHLFAQANSLAVAVI-----------DDELALTASADIRFTRQVKQGERVVAKAKVTAVEKEKGRTVVEVNSYVGEEIVFSGRFDMYRSKHS................. 151
40 -14.9002hbo_A mol:protein length:158 Hypothetical protein (np_422103.1)  ali model follow..  10  45.......RLAFRVEEHHTNGLGNCHGGMLMSFADMAWGRIISL--------QKSYSWVTVRLMCDFLSGAKLGDWVEGEGELISEEDMLFTVRGRIW--AGERTLITGTGVFKALSAR................. 145
41 -14.9003lw3_A mol:protein length:145 HP0420 homologue  ali model follow..  12  39.......TVCLTPKEFMLCEDDVVHAGFIVGAASFAALCALNKKNS-----------LISSMKVNLLAPIEIKQEIYFNATITHTSSKKSTIRVEGE--FMEIKVFEGDFEILVFEKRPFKFNFKED........ 145
42 -14.6003b7k_A mol:protein length:333 Acyl-coenzyme A thioesterase 12  ali model follow..  10  26............IQPAHATARGELSAGQLLKWID--------TTACLAAEKHAGVSCVTASVDIQFEETARVGQVITIKAKVTRAFSTSMEISIKVMLTGIEKLVSVAFSTFVAKPVGKEKIHLKPVTLLTEQDH 145
43 -14.5003p2q_A mol:protein length:143 Fluoroacetyl coenzyme A thioesterase  ali model follow..  12  42.....................EVFATGFMVGLMEWACVRAMAP------YLEPGEGSLGTAICVTHTAATPPGLTVTVTAELRSVEGRRLSWRVSAH--DGVDEIGSGTHERAVIHLEKFNAKVRQKTPAG.... 143
44 -14.2002q78_A mol:protein length:153 Uncharacterized protein  ali model follow..  41......................LVATSALIGVVHRVSYELLSR------YLPNDYTAVVVETLARHVKAVPTGTRVAVGVRVVGVVGNRVKFRGIVM--SGDEKILEAEFVRAIVPREKLRRLALEKAEKTSRL. 144
45 -14.2002cwz_A mol:protein length:141 thioesterase family protein  ali model follow..  12  29..................PVHPVYATYWMVKHMELAGRKIILP------FLEEGEEGIGSYVEARHLASALPGMRVRVVARHEKTEGNRVYARVEAY-NELGDLIGVGRTEQVILPKAKVEALFRRLKERWEAER 138
46 -14.0003lbb_A mol:protein length:163 Putative uncharacterized protein smu.793  ali model follow..  54.......IVTTEVVDKSLNYYGFAHGGYIFTLCDQI---------SGLVSISTGFDAVTLQSSINYLKSGKLGDTLLIDGRCVHDGRTTKVVDVTVTNQ-LKQEVAKATFTMFVTGKRKDD.............. 157
47 -13.8003qoo_A mol:protein length:138 Uncharacterized protein  ali model follow..  37.....................EFMSTAAFLETMTQLAVEILDH------KLPEGFVSVGVRSEVHNLAPAVLGDDVTFTVTVDRVEGNRVVLSMKADDPHG--PVATGLQERVVVSTDLLEKRVWERFGGR.... 138
48 -13.7002ov9_A mol:protein length:216 Hypothetical protein  ali model follow..  10  127.....................GHVHGGVSALLLDHV---------LGVANAWGGKAGMTAQLSTRYHRPTPLFEPLTLTGKLMSVDGRKITTAGDI-RTADGQVCVSVEGLFVDKTVP................. 213
49 -13.6003gek_A mol:protein length:146 Putative thioesterase yhdA  ali model follow..  31.......SSKMILSDFHAQPQGFLNGGASLALAEITAG--------SNAIGSGQYFAFGQSINANHLNPKKCEGFVNARGLLLKNGKRNHVWEIKITDE-NETLISQITVVNALVPQKNSDKL............ 139
50 -13.6002fs2_A mol:protein length:151 Phenylacetic acid degradation protein paaI  ali model follow..  36.......VVTMTVTAQMLNGHQSCHGGQLFSLADTA---------FAYACNSQGLAAVASACTIDFLRPGFAGDTLTATAQVRHQGKQTGVYDIEIVNQ-QQKTVALFRGKSHRIGGT................. 136
51 -13.2001ixl_A mol:protein length:131 hypothetical protein PH1136  ali model follow..  15  40.................VDEKGLVHGGFTFGLADYAAMLAVNEPTV-----------VLGKAEVRFTKPVKVGDKLVAKAKIIEDLGKKKIVEVKVY--REEEVVLEGKFYCYVLEKH................. 127
52 -12.5001j1y_A mol:protein length:136 PaaI protein  ali model follow..  22.......VVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRG-----------AVALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVV--SEGKLVALFTGTVFRLGGDGDDVP............ 125
53 -12.2003dkz_A mol:protein length:142 Thioesterase superfamily protein  ali model follow..  10  32.......RTRLPARADLVNSRGDIHGGTLMSVLDFT-------LGAAIRGDTPEVGVATIDMNTSFMSPGR--GDLVIETRCLRRGASIAFCEGEIR-DSAGELVAKATATFKIIQRR................. 132
54 -12.1002pim_A mol:protein length:141 Phenylacetic acid degradation-related protein  ali model follow..  40.......ESDYVATDAFLNPVGQVQGGMLGAMLDDVTAMLVTA------TLEDGASCSTLNLNLSFLRPAQ-AGLLRGRARLERRGRNVCNVVGELS--QDGKLVATATATCMVARRA................. 141
55 -11.7001q4s_A mol:protein length:151 Thioesterase  ali model follow..  11  47.......TASVEVTDTLRQRWGLVHGGAYCALAEML------TEATVAVVHEKGMMAVGQSNHTSFFRPVK-EGHVRAEAVRIHAGSTTWFWDVSL-RDDAGRLCAVSSMSIAVRPRR................. 150
56 -11.7003R3D Entity 1(prereleased)  ali follow..  12  47.......TASVEVTDTLRQRWGLVHGGAYCALAEML------SEATVAVVHEKGMMAVGQSNHTSFFRPVK-EGHVRAEAVRIHAGSTTWFWDVSL-RDDAGRLCAVSSMSIAVRPRR................. 150
57 -11.6003nwz_A mol:protein length:176 BH2602 protein  ali model follow..  10  65.......EVRLPIGPLVNNPLNMVHGGITATLLDTAMG-------MVNRQLPDGQSAVTSELNIHYVKPGM-GTYLRAVASIVHQGKQRIVVEGKVY-TDQGETVAMGTGSFFVLRSRG................ 168
58 -11.6003bnv_A mol:protein length:152 Cj0977  ali model follow..  12  60..................DDQGLIFDAFIFAAANYVAQASINKEFS-----------VIIGSKCFFYAPLKLGDVLELEAHALFDETSK-KRDVKVVGHVKEIKMFEGTIQVVSTDEH................. 147
59 -11.6003R3C Entity 1(prereleased)  ali follow..  11  49.........SVEVTDTLRQRWGLVAGGAYCALAEML------TEATVAVVHEKGMMAVGQSNHTSFFRPVK-EGHVRAEAVRIHAGSTTWFWDVSL-RDDAGRLCAVSSMSIAVRPRR................. 150
60 -11.6001sh8_A mol:protein length:154 hypothetical protein PA5026  ali model follow..  44...............GNENHIGSMYAGALFTLAELPGGALFLT-----SFDSARFYPIVKEMTLRFRRPAK-ERIRQLETEAGERGKAEYSLELQLT-DEQGEVVAESAALYQLRSHARPGS............. 154
61 -11.5003R3A Entity 1(prereleased)  ali follow..  11  47.......TASVEVTDTLRARWGLVHGGAYCALAEML------TEATVAVVHEKGMMAVGQSNHTSFFRPVK-EGHVRAEAVRIHAGSTTWFWDVSL-RDDAGRLCAVSSMSIAVRPRR................. 150
62 -11.5003R32 Entity 1(prereleased)  ali follow..  10  47.......TASVEVTDTLRQRWGLVHGGAYCALAAML------TEATVAVVHEKGMMAVGQSNHTSFFRPVK-EGHVRAEAVRIHAGSTTWFWDVSL-RDDAGRLCAVSSMSIAVRPRR................. 150
63 -11.4003e1e_A mol:protein length:141 Thioesterase family protein  ali model follow..  14  37.......ELCMPYDRALTQQHGFLHAGIVSTVLDSACG-------AAFSLMEEEAAVLTVEFKVNFLNPAE-GERFAFRAEVVKPGRTLTVATATAYRDGEERAIATMTATLMAL.................... 139
64 -11.2001zki_A mol:protein length:133 hypothetical protein PA5202  ali model follow..  33.......EVRLPMAAHLRNRGGVMHGGALFSLMDVTMG-------ACSSSHGFDRQSVTLECKINYIRAVA-DGEVRCVARVLHAGRRSLVVEAEVR--QGDKLVAKGQGTFAQLGS.................. 133
65 -11.2001yoc_A mol:protein length:147 hypothetical protein PA1835  ali model follow..  10  45.......EVTFPKRREVLNHIGTVHAIALCNAAELA---------MTDASIPAGHRWIPRGMTVEYLAKAT-GDVRAVADGSQIDWQATGNLVVPVVAYVDDKPVFRAEITMYVSQA.................. 147
66 -10.9001vh9_A mol:protein length:149 Hypothetical protein ybdB  ali model follow..  39.......EAEMPVDTRTHQPFGLLHGGASAALAETLGS--------GFMMTRDGQCVVGTELNATHHRPVS-EGKVRGVCQPLHLGRQNQSWEIVVF-DEQGRRCCTCRLGTAVLGEGGS............... 143
67 -10.8001vh5_A mol:protein length:148 Hypothetical protein ydiI  ali model follow..  39.......EATMPVDSRTKQPFGLLHGGASVVLAESIGS--------GYLCTEGEQKVVGLEINANHVRSAR-EGRVRGVCKPLHLGSRHQVWQIEIF-DEKGRLCCSSRLTTAILEGGS................ 142
68 -10.8003hdu_A mol:protein length:157 putative thioesterase  ali model follow..  43.....KLSFEMRDELIGNAIRRMLYGGVISSAIDMTAGLAAFMGKPMEEKLAMIGRLSTMSLHVEYLRPGL-GREFVCTGYNVRTGNKVAVIRTELM-NDQDELIAVGSVSYILV.................... 157
69 -10.7003ir3_A mol:protein length:148 3-hydroxyacyl-thioester dehydratase 2  ali model follow..  82.....................................................GPGCVFLSQEISFPAPLYIGEVVLASAEVKKLKRFIAIIAVSCSVIESKKTVMEGWVKVMVPEAS................. 146
70 -10.7003SCC Entity 1(prereleased)  ali follow..  37.......EAEMPVDTRTHQPFGLLHGGASAALAETLGS--------GFMMTRDGQCVVGTELNATHHRPVS-EGKVRGVCQPLHLGRQNQSWEIVVF-DEQGRRCCTCRLGTAVLG................... 137
71 -10.4003s4k_A mol:protein length:144 Putative esterase Rv1847/MT1895  ali model follow..  12  38.......RAQLDVRPKLLQLTGVVHGGVYCAMIESIAS----AAFAWLNSHGEGGSVVGVNNNTDFVRSIS-SGMVYGTAEPLHRGRRQQLWLVTI-TDDTDRVVARGQVRLQNLEAR................. 143
72 -10.4001sbk_A mol:protein length:144 Hypothetical protein ydiI  ali model follow..  37.......EATMPVDSRTKQPFGLLHGGASVVLAESIGS--------GYLCTEGEQKVVGLEINANHVRSAR-EGRVRGVCKPLHLGSRHQVWQIEIF-DEKGRLCCSSRLTTAILLE.................. 138
73 -10.3002b6e_A mol:protein length:146 Hypothetical UPF0152 protein HI1161  ali model follow..  37.......EATMPVDHRTMQPFGVLHGGVSVALAETIGS--------GSLCLEEGKTVVGLDINANHLRPVR-SGKVTARATPINLGRNIQVWQIDIR-TEENKLCCVSRLTLSVINLL................. 139
74 -10.2003e29_A mol:protein length:144 uncharacterized protein Q7WE92_BORBR  ali model follow..  37.......GIKWREELISSPEIRSTHGGILATLVDAAGDYAVAL--------KTGHPVPTMDMHVDYHRVAT-PGDLRAEGQVIHFGKRFATAHARVL-DMDGNLVASGRALYLIRAPL................. 137
75 -10.1003SC9 Entity 1(prereleased)  ali follow..  37.......EATMPVDSRTKQPFGLLHGGASVVLAESIGS--------GYLCTEGEQKVVGLEINANHVRSAR-EGRVRGVCKPLHLGSRHQVWQIEIF-DEKGRLCCSSRLTTAIL.................... 136

FFAS is supported by the NIH grant R01-GM087218-01
6 0 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.