current user: public




3R4V1
Query: 3R4V Entity 1(prereleased), from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MPVKVCLIFAGGTGMNVATKLVDLGEAVHCFDTCDKNVVDVHRSVNVTLTKGTRGAGGNRKVILPLVRPQIPALMDTIPEADFYIVCYSLGGGSGSVLGPLITGQLADRKASFVSFVVGAMESTDNLGNDIDTMKTLEAIAVNKHLPIVVNYVPNTQGRSYESINDEIAEKIRKVVLLVNQNHGRLDVHDVANWVRFTDKHNYLIPQVCELHIETTRKDAENVPEAISQLSLYLDPSKEVAFGTPIYRKVGIMKVDDLDVTDDQIHFVINSVGVVEIMKTITDSKLEMTRQQSKFTQRNPIIDADDNVDEDGMVVLast
1 -78.1003R4V Entity 1(prereleased)  ali  100  1MPVKVCLIFAGGTGMNVATKLVDLGEAVHCFDTCDKNVVDVHRSVNVTLTKGTRGAGGNRKVILPLVRPQIPALMDTIPEADFYIVCYSLGGGSGSVLGPLITGQLADRKASFVSFVVGAMESTDNLGNDIDTMKTLEAIAVNKHLPIVVNYVPNTQGRSYESINDEIAEKIRKVVLLVNQNHGRLDVHDVANWVRFTDKHNYLIPQVCELHIETTRKDAENVPEAISQLSLYLDPSKEVAFGTPIYRKVGIMKVDDLDVTDDQIHFVINSVGVVEIMKTITDSKLEMTRQQSKFTQRNPIIDADDNVDEDGMVV 315
2 -76.4003RB8 Entity 1(prereleased)  ali follow..  100  2.PVKVCLIFAGGTGMNVATKLVDLGEAVHCFDTCDKNVVDVHRSVNVTLTKGTRGAGGNRKVILPLVRPQIPALMDTIPEADFYIVCYSLGGGSGSVLGPLITGQLADRKASFVSFVVGAMESTDNLGNDIDTMKTLEAIAVNKHLPIVVNYVPNTQGRSYESINDEIAEKIRKVVLLVNQNHGRLDVHDVANWVRFTDKHNYLIPQVCELHIETTRKDAENVPEAISQLSLYLDPSKEVAFGTPIYRKVGIMKVDDLDVTDDQIHFVINSVGVVEIMKTITDSKLEMTRQQSKFTQRNPIIDADDNVDEDGMVV 315
3 -35.6002xkb_A mol:protein length:427 FTSZ/TUBULIN-RELATED PROTEIN  ali model follow..  12  21ISIRWGVIGAGQKGNKEADLFAGYKYPTLAVNFAESDMMHLQNIEDRIHFDGLKGAARTPSVVTDLFDPETNPNANGYVIVDQFLICLGAGGGVGTGWGSLVLQLIREQFFPCPVSMLISLPSGDP-DEINNALVLLSEIDEFMRELANVIVNDNTQMQRKEVANDNVVSTLHEINIIPESDNVTYDPSDLIKLLS--IPGRFLTIGKARIAKFDLHSLENSIKRSLDEGFFSAEHQFELGEYKRLDEIAGKFGDPIWDNEYAVCYTIFAGMTMPKRYISLAREGKELAEKQEQLRAEAQRKQDEEKVD...... 416
4 -35.3003m89_A mol:protein length:427 FtsZ/tubulin-related protein  ali model follow..  12  35ISIRWGVIGAGQKGNKEADLFAGYKYPTLAVNFAESDMMHLQNIEDRIHFDGLKGAARTPSVVTDLFDPETNPNANGYVIVDQFLICLGAGGGVGTGWGSLVLQLIREQFFPCPVSMLISLPSGDP-DEINNALVLLSEIDEFMRELANVIVNDNTQMQRKEVANDNVVSTLHEINIIPGSDNVTYDPSDLIKLLS--IPGRFLTIGKARIAKFDLHSLENSIKRSLDEGFFSAEHQFE-TATMYGGFVLRPSNADFFKDVNTVCYTIFAGMTMPKRYISLAREGKELAEKQEQLRAEA................ 420
5 -35.1003m8k_A mol:protein length:428 FtsZ/tubulin-related protein  ali model follow..  13  21ISIRWGVIGAGQKGNKEADLFAGYKYPTLAVNFAESDMMHLQNIEDRIHFDGLKGAARTPSVVTDLFDPETNPNANGYVIVDQFLICLGAGGGVGTGWGSLVLQLIREQFFPCPVSMLISLPSGDP-DEINNALVLLSEIDEFMRELANVIVNDNTQMQRKEVANDNVVSTLHEINIIPESDNVTYDPSDLIKLLS--IPGRFLTIGKARIAKFDLHSLENSIKRSLDEGFFSAEHQFETATMYGGFEIAGKFGDPIWDNEYAVCYTIFAGMTMPKRYISLAREGKELAEKQEQLRAEAQRKQDEEKVD...... 416
6 -34.0001fsz_A mol:protein length:372 FTSZ  ali model follow..  15  37.KAKITVVGCGGAGNNTITRLKMEGAKTVAINTDAQQLKADKKILIGKKLTRGLGAGGNPKIGEEAAKESAEEIKAAIQDSDMVFITCGLGGGTGTGSAPVVAEISKKIGALTVAVVTLPFVM-EGKVRMKNAMEGLERLKQHTDTLVVIPNENMPLKLAFKVADEVLINAVKGLVELITDGLINVDFADVKAV---MNNGGLAMIGIGESD--SEKRAKEAVSMALNSPLLDVDID---GATGALIHVMGPEDLTLEEAREVVATVSSRLDPNATIIWGATIDENLENTVRVL..................... 334
7 -33.8002r6r_1 mol:protein length:338 Cell division protein ftsZ  ali model follow..  15  7.PCKIKVIGVGGGGSNAVNRMYEEGVELYAINTDVQHLKVPNKIQIGEKVTRGLGAGAKPEVGEEAALEDIDKIKEILRDTDMVFISAGLGGGTGTGAAPVIAKTAKEMGILTVAVATLPFRF-EGPRKMEKALKGLEKLKESSDAYIVIHNDTLTIKDAFKEVDSVLSKAVRGITSIVVPAVINVDFADVRTT---LEEGGLSIIGMGEGR--GDEKADIAVEKAVTSPLL--EGNTIEGARRLLVTIWTSEDIPYDIVDEVMERIHSKVHPEAEIIFGAVLEPQEQDFIRVA..................... 306
8 -33.4002rhh_A mol:protein length:325 Cell Division Protein ftsZ  ali model follow..  14  3...SIKVIGVGGGGNNAVNRMIEQGVEYIAVNTDAQALKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTF-EGRKRQLQAAGGISAMKEAVDTLIVIPNDNTPMLEAFREADNVLRQGVQGISDLIAPGLINLDFADVKTI---MSNKGSALMGIGIAT--GENRAAEAAKKAISSPLLEAAID---GAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVT..................... 299
9 -33.2001rlu_A mol:protein length:382 Cell division protein ftsZ  ali model follow..  11  12..AVIKVVGIGGGGVNAVNRMIEKGVEFIAINTDAQALDADVKLDVGRDSTRGLGAGADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSF-EGKRRSNQAENGIAALRESCDTLIVIPNDAVSLMDAFRSADEVLLNGVQGITDLITPGLINVDFADVKGI---MSGAGTALMGIGSAR--GEGRSLKAAEIAINSPLLEASME---GAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSLGDEVRVTVIAAG................ 314
10 -33.1002vam_A mol:protein length:382 CELL DIVISION PROTEIN FTSZ  ali model follow..  14  12..ASIKVIGVGGGGNNAVNRMIEQGVEYIAVNTDAQALKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTF-EGRKRQLQAAGGISAMKEAVDTLIVIPNDNTPMLEAFREADNVLRQGVQGISDLIAPGLINLDFADVKTI---MSNKGSALMGIGIAT--GENRAAEAAKKAISSPLLEAAID---GAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATG................ 314
11 -32.9002vaw_A mol:protein length:394 CELL DIVISION PROTEIN FTSZ  ali model follow..  12  12..AVIKVIGVGGGGGNAVNHMAKEGVEFICANTDAQALAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPF-EGRKRMQIADEGIRALAESVDSLITIPNEDASLLAAFAKADDVLAGAVRGISDIIKPGMINVDFADVKTV---MSEMGMAMMGTGCAS--GPNRAREATEAAIRNPLL--EDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADMRDELHVTVVATG................ 315
12 -32.3001w5f_A mol:protein length:353 CELL DIVISION PROTEIN FTSZ  ali model follow..  11  22..LKIKVIGVGGAGNNAINRMIEHGVEFVAVNTDLQVLNADVKIQIGENITRGLGAGGRPEIGEQAALESEEKIREVLQDTHMVFITAGFGGGTGTGASPVIAKIAKEMGILTVAIVTTPFYF-EGPERLKKAIEGLKKLRKHVDTLIKISNNDVKIKDAFLKADETLHQGVKGISELITRGYIRLT-SRFARIESVMKDAGAAILGIGVGK--GEHRAREAAKKAMESKLIEHPVE---NASSIVFNITAPSNIRMEEVHEAAMIIRQNSSEDADVKFGLIFDDEVPDDE........................ 318
13 -17.0002bto_A mol:protein length:473 TUBULIN BTUBA  ali model follow..  16  1MKVNTIVVSIGQAGNQIAASFWKT--RAIMVDLEPSVIDNVKAFNPANLISRTEGAGGN-GAGREVLPEVMSRLDYEIDKCDNVIVLHAIGGGTGSGFGALLIESLKEKYGEIPVLSCAVLPSSSVVTEPYNTVFALNTLRRSADACLIFDNEANIESPTVDDLNLLITEALAGIMRFSGFLTVEISLRELLTNLVPQPSLHFLMCAFAPLTPPDRSKFEELGIEEMIKSLFDNGS............................................................................... 304
14 -16.7003cb2_A mol:protein length:475 tubulin gamma-1 chain  ali model follow..  16  1MPREIITLQLGQCGNQIGFEFWKQ--RAVLLDLEPRVIHSILNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNSDVVVQPYNSLLTLKRLTQNADCLVVLDNTAHIQNPSFSQINQLVSTIMSASTTTLRPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTT........................................................................................... 289
15 -15.8002xrp_B mol:protein length:452 TUBULIN ALPHA-1D CHAIN  ali model follow..  13  3...ECISIHVGQAGVQIGNACWEL--RAVFVDLEPTVIDEVRTGTYRQLITGKEDAANNYARGHDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPASTAVVEPYNSILTTHTTLEHSDCAFMVDNEADIERPTYTNLNRLIGQIVSSITASLRDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN............................................................................... 300
16 -15.7001z2b_B mol:protein length:445 Tubulin beta chain  ali model follow..  15  3...EIVHIQAGQCGNQIGAKFWEV--RAILVDLEPGTMDSVRSGPFGQIVFGQSGAGNN-TEGAELVDSVLDVVRKESESCDCLQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSSDTVVEPYNATLSVHQLVENTDETYSIDNEAKLTTPTYGDLNHLVSATMSGVTTCLRPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKN............................................................................... 298
17 -15.7003ryc_B mol:protein length:445 Tubulin beta chain  ali model follow..  15  3...EIVHIQAGQCGNQIGAKFWEV--RAILVDLEPGTMDSVRSGPFGQIVFGQSGAGNN-TEGAELVDSVLDVVRKESESCDCLQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSSDTVVEPYNATLSVHQLVENTDETYSIDNEAKLTTPTYGDLNHLVSATMSGVTTCLRPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKN............................................................................... 298
18 -15.6003du7_A mol:protein length:449 Tubulin alpha-1C chain  ali model follow..  10  3...ECISIHVGQAGVQIGNACWEL--RAVFVDLEPTVIDEVRT-HPEQLISGKEDAANN-TIGKEIIDLVLDRVRKLADQCTGLLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPASTAVVEPYNSILTTHTTLEHSDCAFMVDNEADIERPTYTNLNRLMSQIVSSITASLRDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN............................................................................... 300
19 -15.5002btq_B mol:protein length:426 TUBULIN BTUBB  ali model follow..  15  3...EILSIHVGQCGNQIADSFWRL--RAVLVDLEPGVIARIEGGDMSQLVRKIPGAANN-VEGEKVIDQIMNVIDSAVEKTKGLLMTHSIGGGSGSGLGSLILERLRQAYPKKRIFTFSVVPSSDSAVEPYNAILTLQRILDNADGAVLLDNEALNRSPNYMDLNNIIALIVSSVTASLRPGKLNTDLSEFVTNLVPFPGNHFLTASFAPMRGAGQEGQVRTNFPDLARETFAQDN............................................................................... 298
20 -15.5003ryc_A mol:protein length:451 Tubulin alpha chain  ali model follow..  11  3...ECISIHVGQAGVQIGNACWEL--RAVFVDLEPTVIDEVRT-HPEQLITGKEDAANN-TIGKEIIDLVLDRIRKLADQCTGLLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPASTAVVEPYNSILTTHTTLEHSDCAFMVDNEADIERPTYTNLNRLISQIVSSITASLRDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN............................................................................... 300
21 -15.5001ffx_B mol:protein length:445 PROTEIN (TUBULIN)  ali model follow..  14  3...EIVHIQAGQCGNQIGAKFWEV--RAILVDLEPGTMDSVRSGPFGQIVFGQSGAGNN-TEGAELVDSVLDVVRKESESCDCLQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSSDTVVEPYNATLSVHQLVENTDETYCIDNEAKLTTPTYGDLNHLVSATMSGVTTCLRPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNM.............................................................................. 299
22 -15.4001z2b_A mol:protein length:448 Tubulin alpha chain  ali model follow..  11  3...ECISIHVGQAGVQIGNACWEL--RAVFVDLEPTVIDEVRTGTYRQLITGKEDAANN-TIGKEIIDLVLDRIRKLADQCTGLLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPASTAVVEPYNSILTTHTTLEHSDCAFMVDNEADIERPTYTNLNRLIGQIVSSITASLRDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN............................................................................... 300
23 -11.0001lss_A mol:protein length:140 Trk system potassium uptake protein trkA homo  ali model follow..  10  4.GMYIIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASAEIDALVI---NGDCTKIKTLEDAGIEDADMYIAVTGKEEVNLMSSLLAKSYG............................................................................................................................................................................................................................ 94
24 -10.6002g1u_A mol:protein length:155 hypothetical protein tm1088a  ali model follow..  14..KYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSEFSGFTV---VGDAAEFETLKECGMEKADMVFAFTNDDSTNFFISMNARYM-FNVENVIARV.................................................................................................................................................................................................................. 112
25 -10.3003l4b_C mol:protein length:218 TrkA K+ Channel protien TM1088B  ali model follow..  1..MKVIIIGGETTAYYLARSMLSRKYGVVIINKDRELCEEFAKKLKATIIH---GDGSHKEILRDAEVSKNDVVVILTPRDEVNLFIAQLVMKD--GVKRVVSLVNDPGNMEIITTVLNLTTLITNTVEALIFPDEFSSIIPLEQGIEFLSV................................................................................................................................................................... 151
26 -10.1003h2s_A mol:protein length:224 Putative NADH-flavin reductase  ali model follow..  15  1..MKIAVLGAGRAGSAIVAEARRRGHEVLAVVRDPQKAADRLGAT------------------ATLVKEPLVLTEADLDSVDAVVDALSVPWGSGLDFATHLVSLLRNSDTLAVFIL...................................................................................................................................................................................................... 104
27 -10.1003dqp_A mol:protein length:219 Oxidoreductase ylbE  ali model follow..  1..MKIFIVGSGRVGKSLLKSLSTTDYQIYAGARKVEQVPQYNNV----------------KAVHFDVDWTPEEMAKQLHGMDAIINVSGSGGKSLLKVAVKLMQAAEKAEVKRFILLSTI--------FSLQPEKWIGAGFDALKDYYIAKHFADLYLTKETNLDYTIIQ--TGLIDINDEVSASNTIGDVADTI........................................................................................................................ 181
28 -9.7801id1_A mol:protein length:153 PUTATIVE POTASSIUM CHANNEL PROTEIN  ali model follow..  2RKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDRCRAILALSDNDADNAFVVLSAKDMSSDV-KTVLAVSDSKNLNKI......................................................................................................................................................................................................... 114
29 -9.7103llv_A mol:protein length:141 Exopolyphosphatase-related protein  ali model follow..  11  5GRYEYIVIGSEAAGVGLVRELTAAGKKVLAVDKSKEKIELLEDEGFDAVI----ADPTDESFYRSLDLEGVSAVLITGSDDEFNLKILKALRSVS--DVYAIVRVSSPKKKEEF......................................................................................................................................................................................................... 112
30 -9.3303e8x_A mol:protein length:236 Putative NAD-dependent epimerase/dehydratase  ali model follow..  11  14QGMRVLVVGAGKVARYLLSELKNKGHEPVAMVRNEEQGPELRERGASDIVV----------------ANLEEDFSHAFASIDAVVFAAGSGPHTGA-GAIKTIQEAEKRGIKRFIMVSSV--GTVDPDQGPMNMRHYLVAKRLADDELKRSSLDYTIVRPGPLSNEESTGKV-TVSPHFSEITRSITRHDVAKVI........................................................................................................................ 198
31 -9.0903ew7_A mol:protein length:221 Lmo0794 protein  ali model follow..  14  1..MKIGIIGAGRAGSRILEEAKNRGHEVTAIVRNAGKITQTHKDINI------------------LQKDIFDLTLSDLSDQNVVVDAYGISPDEAE-SLDHLISVLNGTVSPRLLVVGGA................................................................................................................................................................................................... 104

FFAS is supported by the NIH grant R01-GM087218-01
6 0 4 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jambon M, Godzik A. New avenues in protein function prediction. Protein Sci. 2006 Jun;15(6):1527-9.