current user: public




3QX61
Query: 3QX6 Entity 1(prereleased), from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst GMRIPLVGKEPIEAEDMGFTLIHEHLRVFSEAVRYQWPHLYNEDEELRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEKVVKTTGINLVAGTGIYIYVDLPFYFLNRSIDEIADLFIHDIKEGIQATSNKAGFVXIAADEPGITKDVEKVIRAAAITHKEAKVPIITHSNAHNNTGLEEQRILMEEGVDPGKILIGHLGDTDNTDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTLKLIKDGYSDRIMISHDYCCTIDWGTARPELKPKLAPRWSMALIFEDTIPFLKKNGVSEEVIDIIFKENPKKFFSLast
1 -90.2003QX6 Entity 1(prereleased)  ali  100  1GMRIPLVGKEPIEAEDMGFTLIHEHLRVFSEAVRYQWPHLYNEDEELRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEKVVKTTGINLVAGTGIYIYVDLPFYFLNRSIDEIADLFIHDIKEGIQATSNKAGFVXIAADEPGITKDVEKVIRAAAITHKEAKVPIITHSNAHNNTGLEEQRILMEEGVDPGKILIGHLGDTDNTDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTLKLIKDGYSDRIMISHDYCCTIDWGTARPELKPKLAPRWSMALIFEDTIPFLKKNGVSEEVIDIIFKENPKKFFS 315
2 -88.4003UF9 Entity 1(prereleased)  ali follow..  91  1.MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVXIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTLRLIKDGYSDKIMISHDYCCTIDWGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS 314
3 -88.2002vc5_A mol:protein length:314 ARYLDIALKYLPHOSPHATASE  ali model follow..  91  1.MRIPLVGKDSIESKDIGFTLIHEHLRVFSEAVRQQWPHLYNEDEEFRNAVNEVKRAMQFGVKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIHDIKEGIQGTLNKAGFVKIAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHNNTGLEQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETTLRLIKDGYSDKIMISHDYCCTIDWGTAKPEYKPKLAPRWSITLIFEDTIPFLKRNGVNEEVIATIFKENPKKFFS 314
4 -78.5003a3w_A mol:protein length:329 Phosphotriesterase  ali model follow..  30  2.GDLINTVRGPIPVSEAGFTLTHEHICASSAGFLRAWPEFFSRKALVEKAVRGLRHARAAGVQTIVDVSTFDIGRDVRLLAEVSQAADVHIVAATGLWFDP--PLSMRMRSVEELTQFFLREIQHGIEDTGIRAGIIKVA-TTGKATPFQELVLRAAARASLATGVPVTTHTSASPRGGEQQAAIFESEGLSPSRVCIGHSDDTDDLSYLTGLAARGYLVGLDRMPYSATGSWQTRALLIKALIDRGYKDRILVSHDWLFGFSSYVTNIMDVMDRINPDGMAFVPLRVIPFLREKGVPPETLAGVTVANPARFLS 327
5 -77.9003htw_A mol:protein length:328 Organophosphate hydrolase  ali model follow..  26  1...TAQTVTGAVAAAQLGATLPHEHVIFGYPGYAGDVTLGPFDHAALASCTETARALLARGIQTVVDATPNDCGRNPAFLREVSEATGLQILCATGFYYEGEGATTSLGDAESEIYEMMRTEVTEGIAGTGIRAGVIKLASSRDAITPYEQLFFRAAARVQRETGVPIITHTQE-GQQGPQQAELLTSLGADPARIMIGHMDGNTDPAYHRETLRHGVSIAFDRIGLQGTPTDAERLSVLTTLLGEGYADRLLLSHDSIWHWLGRPPAPEAALPAVKDWHPLHISDDILPDLRRRGITEEQVGQMTVGNPARLFG 322
6 -77.8003a4j_A mol:protein length:329 Phosphotriesterase  ali model follow..  30  2.GDLINTVRGPIPVSEAGFTLTHEHICGSSAGFLRAWPEFFSRKALAEKAVRGLRHARAAGVQTIVDVSTFDIGRDVRLLAEVSRAADVHIVAATGLWFDP--PLSMRMRSVEELTQFFLREIQHGIEDTGIRAGIIKVA-TTGKATPFQELVLRAAARASLATGVPVTTHTSASQRGGEQQAAIFESEGLSPSRVCIGHSDDTDDLSYLTGLAARGYLVGLDRMPYSANRSWQTRALLIKALIDRGYKDRILVSHDWLFGFSSYVTNIMDVMDRINPDGMAFVPLRVIPFLREKGVPPETLAGVTVANPARFLS 327
7 -77.3002d2g_A mol:protein length:329 phosphotriesterase  ali model follow..  30  2.GDLINTVRGPIPVSEAGFTLTHEHICGSSAGFLRAWPEFFSRKALAEKAVRGLRHARAAGVQTIVDVSTFDIGRDVRLLAEVSRAADVHIVAATGLWFDP--PLSMRMRSVEELTQFFLREIQHGIEDTGIRAGIIKVA-TTGKATPFQELVLKAAARASLATGVPVTTHTSASQRDGEQQAAIFESEGLSPSRVCIGHSDDTDDLSYLTGLAARGYLVGLDRMPYSAIGSWQTRALLIKALIDRGYKDRILVSHDWLFGFSSYVTNIMDVMDRINPDGMAFVPLRVIPFLREKGVPPETLAGVTVANPARFLS 327
8 -77.3003URB Entity 1(prereleased)  ali follow..  31  1..DRINTVRGPITISEAGFTLTHEHICGSSAGFLHAWPEFFGSRALVEKAVRGLRRARAAGVRTIVDVSTFDCGRDVSLLAEVSRAADVHIVAATGLWID--PPLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIXVA-TTGKATPFQELVLRAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDGIPWSAIGSWQTRALLIKALIDQGYMKQILVSNDWTFGFSSYVTNIMDVLDRVNPDGMAFIPLRVIPFLREKGVPQETLAGITVTNPARFLS 325
9 -77.2003gtx_A mol:protein length:339 Organophosphorus hydrolase  ali model follow..  26  10.HMTAQTVTGAVAAAQLGATLPHEHVIFGYPGYAGDVTLGFDHAAALASCTETARALLARGIQTVVDATPNGCGRNPAFLREVSEATGLQILCATGFYYEGGGARASLGDAESEIYEMMRTEVTEGIAGTGIRAGVIKLASSRDAITPYEQLFFRAAARVQRETGVPIITHTQE-GQQGPQQAELLTSLGADPARIMIGHMDGNTDPAYHRETLRHGVSIAFDRIGLQGTPTDAERLSVLTTLLGEGYADRLLLSHDSIWHWLGRPPAPEAALPAVKDWHPLHISDDILPDLRRRGITEEQVGQMTVGNPARLFG 333
10 -77.1003UR2 Entity 1(prereleased)  ali follow..  30  1..DRINTVRGPITISEAGFTLTHEHICGSSAGFLRAWPEFFSRKALVEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDP--PLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIXVA-TTGKATPFQELVLRAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDGIPWSAIGSWQTRALLIKALIDQGYMKQILVSNDWTFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIPFLREKGVPQETLAGITVTNPARFLS 325
11 -77.0003UPM Entity 1(prereleased)  ali follow..  30  1..DRINTVRGPITISEAGFTLTHEHICGSSAGFLRAWPEFFSRKALAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDP--PLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIXVA-TTGKATPFQELVLRAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDQIPFSANRSWQTRALLIKALIDQGYMKQILVSNDWLFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIPFLREKGVPQETLAGITVTNPARFLS 325
12 -76.5003f4c_A mol:protein length:332 Organophosphorus hydrolase  ali model follow..  33  2.AKTVETVLGPVPVEQLGKTLIHEHFLFGYPGFQGDVTRGTFRDEALRVAVEAAEKMKRHGIQTVVDPTPNDCGRNPAFLRRVAEETGLNIICATGYYYEGEQFRRLLGTAEDDIYDMFMAELTEGIADTGIKAGVIKLASSKGRITEYEKMFFRAAARAQKETGAVIITHTQE-GTMGPEQAAYLLEHGADPKKIVIGHMCGNTDPDYHRKTLAYGVYIAFDRFGIQGAPTDEERVRTLLALLRDGYEKQIMLSHDTVNVWLGPFTLPEPFAEMMKNWHVEHLFVNIIPALKNEGIRDEVLEQMFIGNPAALFS 325
13 -76.4003gtf_A mol:protein length:337 Organophosphorus hydrolase  ali model follow..  27  1GDATAQTVTGAVAAAQLGATLPHEHVIFGYPGYAGDVTLGFDHAAALASCTETARALLARGIQTVVDATPNGCGRNPAFLREVSEATGLQILCATGFYYEGGGATTSLGDAESEIYEMMRTEVTEGIAGTGIRAGVIKLASSRDAITPYEQLFFRAAARVQRETGVPIITHTQE-GQQGPQQAELLTSLGADPARIMIGHMDGNTDPAYHRETLRHGVSIAFDRIGLQGTPTDAERLSVLTTLLGEGYADRLLLSHDSIWHWLGRPPAPEAALPAVKDWHPLHISDDILPDLRRRGITEEQVGQMTVGNPARLFG 331
14 -76.4003gu1_A mol:protein length:337 Organophosphorus hydrolase  ali model follow..  25  1GDATAQTVTGAVAAAQLGATLPHEHVIFGYPGYAGDVTLGFDHAAALASCTETARALLARGIQTVVDATPNDCGRNPAFLREVSEATGLQILCATGFWYEGEGATTSLGDAESEIYEMMRTEVTEGIAGTGIRAGVIKLASSRDAITPYEQLFFRAAARVQRETGVPIITHTQE-GQQGPQQAELLTSLGADPARIMIGHMDGNTDPAYHRETLRHGVSIAFDRIGLQGTPTDAERLSVLTTLLGEGYADRLLLSHDSIWHWLGRPPAIPEAAPAVKDWHPLHISDDILPDLRRRGITEEQVGQMTVGNPARLFG 331
15 -76.3003ojg_A mol:protein length:330 Phosphotriesterase  ali model follow..  33  1GAEMVETVCGPVPVEQLGKTLIHEHFLFGYPGFQGDVTRGTFRDESLRVAVEAAEKMKRHGIQTVVDPTPNDCGRNPAFLRRVAEETGLNIICATGYYYEGEQFRRLLGTAEDDIYDMFMAELTEGIADTGIKAGVIKLASSKGRITEYEKMFFRAAARAQKETGAVIITHTQE-GTMGPEQAAYLLEHGADPKKIVIGHMCGNTDPDYHRKTLAYGVYIAFDRFGIQGAPTDEERVRTLLALLRDGYEKQIMLSHNTVNVWLGPFTLPEPFAEMMKNWHVEHLFVNIIPALKNEGIRDEVLEQMFIGNPAALFS 329
16 -74.7001bf6_A mol:protein length:291 PHOSPHOTRIESTERASE HOMOLOGY PROTEIN  ali model follow..  30  1............SFDPTGYTLAHEHLHIDLSGFKNNVDCRL---DQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSF-STMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANG---------GYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ 291
17 -73.2003pnz_A mol:protein length:330 Phosphotriesterase family protein  ali model follow..  25  1.MSFIRTFYGDIAPEQLGFTYSHEHIVCVPAYWQERDAD-DLLLDDKEKSQLDVQDFADLGGKTIVDATAVDYGRRVLDVAQISKETGIQIVGTAGFNKSFLYYEWIENTTTDKLTEFVVNEVENGLEGTPYKAGQVKFGTGYNMITPLEEKTIRAVARAHHETKAPIHSHTEA-GTMALEQIEILKQENIPLEYLSIGHMDRNLDPYYHKQVAKTGAFMSFDGIAKIKYAPESARIAAILYLVSEGFEDQILVSGDTARKTYY--------KHYGHGPGLEYIAKKWVPRFEKGFDGEKLVKKFFVDNPARCFT 327
18 -71.6003k2g_A mol:protein length:364 Resiniferatoxin-binding, phosphotriesterase-r  ali model follow..  25  13.SGRIMTVDGPIPSSALGHTLMHEHLQNDCRCWWNPPQEPERQYDDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRRISAETGVQVVMGAGYYLASSMPETAARLSADDIADEIVAEALEGTDGTDARIGLIGEIGVSSDFTAEEEKSLRGAARAQVRTGLPLMVHLPGWFRLAHRVLDLVEEEGADLRHTVLCHMNSHMDPVYQATLAQRGAFLEFDMIGMDFFYADDEVARAILGLADHGYLDRILLSHDVFVKMMLTRYG---------GNGYAFVTKHFLPRLRRHGLDDAALETLMVTNPRRVFD 353
19 -70.7001psc_A mol:protein length:365 PHOSPHOTRIESTERASE  ali model follow..  30  34.GDRINTVRGPITISEAGFTLTHEHICGSSAGFLRAWPEFFSRKALAEKAVRGLRRARAAGVRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWFDP--PLSMRLRSVEELTQFFLREIQYGIEDTGIRAGIIKVA-TTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPHSAIGSWQTRALLIKALIDQGYMKQILVSNDWLFGFSSYVTNIMDVMDRVNPDGMAFIPLRVIPFLREKGVPQETLAGITVTNPARFLS 359
20 -67.7003msr_A mol:protein length:363 amidohydrolases  ali model follow..  23  5.NKFARTVLGDIPVEKLGITDCHDHFIKNGGPEVEEHID--FLMLNVDASIKEFKEFIDRGGSTIVTMDPPNVGRDVLKTLEIAKNLGGNVIMSTGFHKAKFYDKYLAVVPTEEIVKMCVAEIEEGMDESKAKAGIIKAGTGYGAIDRLELKALEVAARTSILTGCPILVHTQL-GTMALEVAKHLIGFGANPDKIQISHLNKNPDKYYEKVIKETGVTLCFDGPDRVKYYPDSLLAENIKYLVDKGLQKHITLSLDAGRILYQRNYGLTKGKQ---TFGLAYLFDRFLPLLKQVGVSKEAIFDILVNNPKRVLA 329
21 -63.8003rhg_A mol:protein length:365 Putative phophotriesterase  ali model follow..  27  2.KGYIQTVTGPVKKADMGLTLPHEHLFNDLSGVVDEPFYEFSHVKPIEDVIFELNNFKELGGKTIVDATSSSIGRDIRKLKQVAELTGINVVASSGLYIEKFEGKRLAD-DIDAMAKMIDDELNIGIDGTDIRAGMIGEIGVSPFFTDGEKNSLRAAALAQNNNPYSMNIHMPGWQRRGDEVLILLTEMGCDPAKISLAHSDPSKDIDYQCKMLDRGVWLEFDMIGLDISFPKEDTVEAVATLIERGYGNQIVLSHDVFLKQMWAKNG---------GNGWGFVPNVFLSLLAQRGIDKTIIDKLCIDNPANLLA 343
22 -36.9001j6o_A mol:protein length:268 TatD-related deoxyribonuclease  ali model follow..  14  3..............SDKIMVDTHAHL----------------HFHQFDDDRNAISSFEENNIEFVVNVGVN---EDSKKSLDLSKTSD-RIFCSVGVHPHD--AKEVPEDFIEHLEKFAKDEKVVAIGETGLD------FFRNISPAEVQKRVFVEQIELAGKLNLPLVVHIRDAYSEAYEILRTESLPEKR-----VIHA-FSSDYEWAKKFIDLGFLLGIGGPVTYP------KNEALREVVKRVGLEYIVLETDCPFLPPQPFRGKRNEP--------KYLKYVVETISQVLGVPEAKVDEATTENARRIFL 258
23 -36.2001yix_A mol:protein length:265 deoxyribonuclease ycfH  ali model follow..  16  1................MFLVDSHCHL---------------LDYESLHKDVDDLAKAAARDVKFCLAVATT---PSYLHMRDLVGERD-NVVFSCGVHPLNQN----DPYDVEDLRRLAAEEGVVALGETGLD------YYYTPETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDCG-----VLHC-FTEDRETAGKLLDLGFYISFSGIVTFR------NAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQP--------AMVRDVAEYMAVLKGVAVEELAQVTTDNFARLFH 255
24 -35.0002gzx_A mol:protein length:265 putative TatD related DNase  ali model follow..  17  2..................LIDTHVHL----------------NDEQYDDDLSEITRAREAGVDRMFVVGFN---STIERAMKLIDEYD-FLYGIIGWHPVDA--IDFTEEHLEWIESLAQHPKVIGIGEMGLD------YHWDKSPADVQKEVFRKQIALAKRLKLPIIIHNREATQDCIDILLEEHAEEVG-----IMHSFSGSPEIADIVTNKLNFYISLGGPVTFK------NAKQPKEVAKHVSMERLLVETDAPYLSPHPYRGKRNEP--------ARVTLVAEQIAELKGLSYEEVCEQTTKNAEKLFN 254
25 -34.9003guw_A mol:protein length:261 uncharacterized protein AF_1765  ali model follow..  15  2..................YFDSHLHSE--------------------GLGFSELVKLKENGIKEVCSLAFPVKPKYPQTMIDVCEAAGVKMHPAVGIHPRCI------PPDYEFVLGYLEEGEWVAFGEIGLELV-----------TDEEIEVLKSQLELAKRMDVPCIIHTPRGNKATRKTLEILESLDFPADLAVIDHV----NFETLDMVLETEYWIGLTVQPGKL------SAEDAARIVAEHGPERFMLNSDAGYRDVEI------------------TTVAEAAVKIEEAVGREEMEKVARENARKFLR 247
26 -34.5001xwy_A mol:protein length:264 Deoxyribonuclease tatD  ali model follow..  11  2...............EYRMFDIGVNL----------------TSSQFAKDRDDVACAFDAGVNGLLITGTN---RESQQAQKLARQYS-SCWSTAGVHPHD--SSQWQAATEEAIIELAAQPEVVAIGECGLD------FNRNFSTPEEQERAFVAQLRIAADLNMPVFMHCRDAHERFMTLLEPWLDKLPG----AVLHC-FTGTREEMQACVAHGIYIGITGW-----VCDERRGLELRELLPLIPAEKLLIETDAPYLLPRDLTPKPSSRRNEP----AHLPHILQRIAHWRGEDAAWLAATTDANVKTLFG 261
27 -33.9002y1h_A mol:protein length:272 PUTATIVE DEOXYRIBONUCLEASE TATDN3  ali model follow..  13  3...............GVGLVDCHCHL----------------SAPDFDRDLDDLEKAKKANVVALVAVAEH---GEFEKIMQLSERYNGFVLPCLGVHPVQGLPVTLKDLDVALPIIENYKDRLLAIGEVGLD--FSPRFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEK------VLLHA-FDGRPSVAMEGVRAGYFFSIPPSIIRS--------GQKQKLVKQLPLTSICLETDSPALGP--EKQVRNEP--------WNISISAEYIAQVKGISVEEVIEVTTQNALKLFP 264
28 -33.8003rcm_A mol:protein length:287 TatD family hydrolase  ali model follow..  14  1................MQLIDIGVNL----------------TNSSFHDQQAAVERALEAGVTQMLLTTSLAVSEQALELCQQLDASGAHLFATAGVHPHD--AKAWDTDSERQLRLLLSEPRVRAVGECGLD------FNRDFSPRPLQEKALEAQLTLAAQLRLPVFLHERDASERLLAILKDYRDHLTG----AVVHC-FTGEREALFAYLDLDLHIGITGW-----ICDERRGTHLHPLVGNIPEGRLMLESDAPYLLPRSLRPKPKSGRNEP----AFLPEVLREVALHRGESAEHTAAHTTATARDFFQ 263
29 -33.4001zzm_A mol:protein length:259 putative deoxyribonuclease yjjV  ali model follow..  12  3................CRFIDTHCHF----------------DFPPFSGDEEALQRAAQAGVGKIIVPATE---ENFARVLALAENYQ-PLYAALGLHPGML--EKHSDVSLEQLQQALEPAKVVAVGEIGLD------LFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLK-----RHDLPRTGVVHG-FSGSLQQAERFVQLGYKIGVGGTITYP------RASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRP--------EQAARVFAVLCELRREPADEIAQALLNNTYTLFN 257
30 -30.6003gg7_A mol:protein length:254 uncharacterized metalloprotein  ali model follow..  15  1................MSLIDFHVHL-------------------DLYPDPVAVARACEERQLTVLSVTTT---AAWRGTLALAAGRP-HVWTALGFH-----PEVVSERAADLPWFDRYLPETRFVGEVGLDG-----SPSLRGTWTQQFAVFQHILRRCEDHGRILSIHSRRAESEVLNCLEANPRSGT-----PILHW-YSGSVTELRRAISLGCWFSVG--------PTMVRTQKGAALIRSMPRDRVLTETDGPFLE---LDGQAALP--------WDVKSVVEGLSKIWQIPASEVERIVKENVSRLLG 243
31 -29.1002xio_A mol:protein length:301 PUTATIVE DEOXYRIBONUCLEASE TATDN1  ali model follow..  14  1................MKFIDIGINLTDPMFRGIYRGVQKHQDDLQ-----DVIGRAVEIGVKKFMITGGN---QDSKDALHLAQTNG-MFFSTVGCHPTRCFEKNNPDLYLKELLNLAEKGKVVAIGECGLDFDRLQF-----CPKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDITKRNRDRCVG-----VVHS-FDGTKEAAAALIDLDLYIGFNGCSLKT--------EANLEVLKSIPSEKLMIETDAPWCGVKSTHAGSKYIRTADRNEPCHIIQILEIMSAVRDEDPLELANTLYNNTIKVFF 291
32 -27.0003ipw_A mol:protein length:325 Hydrolase TatD family protein  ali model follow..  13  4GTLEAQTQGPGSMSMAQQFIDIGANL--TDDNYFGNYHGKHYHEEDIDVV---LQRAERNGLSHIIITSGC---NDFKKAIEIINKYQIKLVTTIGVHPTRT-NELKQEGYLDELLLLCEIDKVVAIGEIGLDYERLQF-----SDKETQLSGYRTLSILHQKPYLPFFFHCRKSWSDLCQLNKELGYNGCK-----VVHC-FDGTEEEMNQILNEGWDIGVTG--------NSLQSIELLNVMKQIPIERLHIETDCPYCGIKKTSAGQRNKYVQRRNEPSNIIDIAIIMSSIKHISLFEFVNKVYSNSMNMYF 315
33 -22.8003e2v_A mol:protein length:401 3`-5`-exonuclease  ali model follow..  11  2......SLTSTATDSPLKYYDIGLNL--TDPMFHGIYNGKQYHPADYVKL---LERAAQRHVKNALVTSIAESQSAIELVSSVKDLSPLKLYHTIGVHPNPSFAQGKLKELYDLMNQQAKDTSFRSIGEIGLDYDRF-----HYSSKEMQKVFFEEQLKISKLSSYPLFLHMRSACDDFVQILERFVVGKFHPDRKLVVHS-FTGSAIDLQKLLNLSPNIFIGVNGCSL------RTEENLAVVKQIPTERLLLETDAPWCEIKRTHASFQYLAKYQEV--CNMEQVAIVVSEVKDVDLATLIDTTWKTTCKIFG 393
34 -19.7003irs_A mol:protein length:291 UNCHARACTERIZED PROTEIN BB4693  ali model follow..  2...............SLKIIDFRLRPPAMRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIEQGVRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAA----------TRKEAMAQMQEILDLGIRIVNLEPGVWATPM------HVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDTVVSSHGNWPWVQEIIHVAFRRNLYLSPDMY-----LYNLPGHADFIQAANSFLADRMLFGTAYPMCP----------------------LKEYTEWFLTLPIKPDAMEKILHGNAERLLA 279
35 -18.2003cjp_A mol:protein length:272 Predicted amidohydrolase, dihydroorotase fami  ali model follow..  11  4..................IIDGHTHVILPVEKHIKIMDEAGVDKTILETAVNLRDVKKEMKKLNDVVNGKTNSMIDVKELTNVIQAYPSRYVGFGNVP-----VGLSENDTNSYIEENIVNNKLVGIG--------------LTPASGQIKSLKPIFKYSMDSGSLPIWIHAFNPLVLQDIKEIAELCKAFPKVPVILGHMGGSNWMTAVELAKEINLYLDTSAYFS----------TFVLKIVINELPLKCIFGTDMPFGDL----------------------QLSIEAIKKMSNDSYVANAVLGDNISRLLN 263
36 -18.0002ffi_A mol:protein length:288 2-pyrone-4,6-dicarboxylic acid hydrolase, put  ali model follow..  12  1.....MRTMPDAPALHLTAIDSHAHVFSRGLNLASQRRYAPNYDAPLGDYLGQLR---AHGFSHGVLVQPSFLGTDNRYLLSALQTVP-GQLRGVVM---------LERDVEQATLAEMARLGVRGV----------RLNLMGQDMPDLTGAQWRPLLERIGEQGWHVELHRQVA-----DIPVLVRALQPYGLDIVIDHFGRQPGFAELLTLSGRGVWVKVSGIYRLQGSPEAFARQALCALEAHYGAERLMWGSDWPHTQ----------------HESEVSFGSAVEQFEALGCSAQLRQALLLDTARALFG 278
37 -15.6003ij6_A mol:protein length:312 UNCHARACTERIZED METAL-DEPENDENT HYDROLASE  ali model follow..  2...............SLTKIDAYAHILMLSVEPNIPNMFPFIKIKTLMDLDERLTKWPDQNTKQVISLANISP-TDSKTSAELCQSANEELSNLVDQHPGKFAGAVAILPMNN--IESACKVISSIKDDENLVGAQIFTRHLGKSIADKE---FRPVLAQAAKLHVPLWMHPVFDAELSQAMLQLVQSQDYPNLKILVHHAGAM-DHILDEKHAQDFKKFYVDTAILGN-------TPALQLAIDYYGIDHVLFGTDAPFAVMPSGAD-----------------QIITQAINDLTISDKDKQKIFHDNYYSLIK 304
38 -15.6002dvt_A mol:protein length:327 Thermophilic reversible gamma-resorcylate dec  ali model follow..  13  2................QGKVALEEHFA-DSAGFVPGDYWKELQHRLLDIQDTRLKLMDAHGIEMILSLNAPAVQPDRRKAIEIARRANDVLAEECAKRPDRFLAFAALPLQDPDAATEELQRCVNDLGFVGALVNGFSQEGDGQTPLYYDLPQYRPFWGEVEKLDVPFYLHPRNPLETAVHALRLMASDEHPRLNIILGHMGRYPAKRRFMDYFNENFHITTSGN----------RTQTLIDAILEIGADRILFSTDWPFEN----------------------IDHASDWFNATSIAEADRVKIGRTNARRLFK 323
39 -15.5002gwg_A mol:protein length:350 4-oxalomesaconate hydratase  ali model follow..  2..................IIDIHGHYTTAPKALEDSELKISDDELQASIIENQLKKMQERGSDTVFSPRASFMAGDFNVSSTWAAICNELCYRVSQLFPDNFIGAAMLPQSPGVDPKTCIPELEKCVKEYGFVAINLDPSGGHWTSPPLTDRIWYPIYEKMVELEIPAMIHVSTSCADTTAFMQCVAGKDFPELKFVIPHGGQEMKKPLLEDHVLNNIFFDTCVYHQ----------PGIDLLNTVIPVDNVLFASEMIG-----------AVRGIDPRTGFYYDDTKRYIEASTILTPEEKQQIYEGNARRVYP 331
40 -15.5003nur_A mol:protein length:357 Amidohydrolase  ali model follow..  14  1.MGSSSSGRENLYFQGMKSITFEEHYVMKVMLEGLEKKTGFTNADELSHHDERIQFMNNQDVQQVLSYGNGSPSLVGQKAIELCQKANDQLANYIAQYPNRFVGFATLPINEPEAA---AREFERCINDLGFKGALIMGRAQDGFLDQDK---YDIIFKTAENLDVPIYLHPAPVNDVGIHAIHLVLSDRYPKLNMIIGHWGAEHLNHSVSYYFKNSFYITPSGM----------TKPQFDLVKKEVGIDRILYAADYPYIEP----------------------EKLGVFLDELGLTDEEKEKISYTNGAKLLG 346
41 -15.3004DI8 Entity 1(prereleased)  ali follow..  10.LSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDML--FALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAV------------------VDPAIDEAELAALHEGGMRG--IRFNFLKRLVDDAPKDKFLEVAGRL-PAGWHVVIYFE--ADILEELRPFMDAIPV---PIVIDHMGRGADMKAFRRLLDSDIWFKATCPDRLDPAGPWDDFARSVAPLVADYADRVIWGTAWPHPNMQDAIPD---------------DGLVVDMIPRIAPTPELQHKMLVTNPMRLYW 291
42 -15.2004d8l_A mol:protein length:303 2-pyrone-4,6-dicarbaxylate hydrolase  ali model follow..  10.LSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDML--FALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAV------------------VDPAIDEAELAALHEGGMRG--IRFNFLKRLVDDAPKDKFLEVAGRL-PAGWHVVIYFE--ADILEELRPFMDAIPV---PIVIDHMGRGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAADYADRVIWGTDWPHPNMQDAIPD---------------DGLVVDMIPRIAPTPELQHKMLVTNPMRLYW 291
43 -15.2003s4t_A mol:protein length:348 Amidohydrolase 2  ali model follow..  13  2................NGKIALEEHFATESAGFVPDKDWPELRSRLLDIQDRRVRLMDEHGIEMILSLNAPAVQADSTRANETARRANDFLAEQVAKQPTRFRGFAALPMQDPELAARELERCVKELGFVGALVNGFSQDNRSAVPLYYDMAQYWPFWETVQALDVPFYLHPRNPLETAVHALRLMGSDKYPALKIILGHMGKYPAKRKIVDYFNENFYLTTSGN----------RTQTLIDAILEIGADRILFSTDWPFEN----------------------IDHAADWFENTSISEADRKKIGWGNAQNLFK 323
44 -14.8002f6k_A mol:protein length:307 metal-dependent hydrolase  ali model follow..  1................MSKIDFHTHYLYVEALKRHVPGDPDGWPTPEWTPQLTLNFMRDNDISSILSLSSPHVNGDKAETIRLVEAANDDGKSLAQQYPDQLGYLASLPIPYELDA---VKTVQQALDQDGALGVTVPTNSRGLYF---GSPVLERVYQELDARQAIVALHPNEPADTTMTFINMLKYEKYPNIKVIIPHAGAQKVYQVDVYDVMHHVYFDVAGA----------LPRQLPTLMSLAQPEHLLYGSDIPYTPL------------------DGSRQLGHALATTDLLTNEQKQAIFYDNAHRLLT 306
45 -14.8002qpx_A mol:protein length:376 Predicted metal-dependent hydrolase of the TI  ali model follow..  1GMDDLSEFV-----DQVPLLDHHCHFLIDGKVPNRDDRLAQVSTEADKDYPLAYHGFLALAKEFALDANNPLAAMNATYNHRIFGHFHFKLLIDTGFVPDDPILAAWWQAFSNDVKQAKAHGFVGFKSIAAYRVGLHLEPVNVIEAAAGIDYMLYHVAPFIIAQDMPLQFHVGYGDADPLLMRDYLKAFTKKGLKVVLLHCYPYHREAGYLASVFPNLYFDISLL----NLGPSGASRVFNEAVELAPYTRILFASDASTYPEMYGLAARQFKQA------------LVAHFNQLPQKKAWINAICWQTSAKLYH 369
46 -14.6002wjd_A mol:protein length:247 TYROSINE-PROTEIN PHOSPHATASE CPSB  ali model follow..  15  2...............AMGMIDIHSHIV----------FDVDDGPKSREESKALLAESYRQGVRTIVETPEEKIAENFLQVREIAKEVASDLVIAYGAEIY-----------TPDVLDKLEKKRIPTLNDS-------RYALIEFSMNTPYRDIHSALSKILMLGITPVIAHIER-------------------------YDALENNEKRVRELIDMGCYTQVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVIASDMHNLDGRPPHMAEAYD------------------LVTQKYGEAKAQELFIDNPRKIVM 243
47 -14.1004dlf_A mol:protein length:303 Amidohydrolase 2  ali model follow..  2...............GALRIDSHQHFWRYRAADYPWIGAGMGVLARDYLPDALHPLMHAQALGASIAVQARAGRDETAFLLELACDEA-RIAAVVGW----------EDLRAPQLAERVAEWRGTKL--RGFRHQLQDEADVRAFVDDAD---FARGVAWLQANDYVYDVLVFERQLPDVQAF-----ARHDAHWLVLDHAGKPA-RAALRELAALHVVCKLSGLVTERASDLRHIEQCLDAALDAFGPQRLMFGSDWPVCLLAASYDE---------------VASLVERWAESRLSAAERSALWGGTAARCYA 287
48 -13.8002hbv_A mol:protein length:334 2-amino-3-carboxymuconate 6-semialdehyde deca  ali model follow..  2...............KKPRIDMHSHFF-DTGSIMMGKNNFRPVYQALWDPAFRIEEMDAQGVDQVTCATPVMFGWEANKAAQWAERMNDFALEFAAHNPQRIKVAQVPLQDLDLACKEASRAVAAGHLGIQIGNHLGDKDLDDATLEAF---------THCANEDIPILVHPWDMMGGQRMLVAMPAETQLAILSLILSGAFERIPKSLKICFGHGGGSFAFEYVDRFFVDSAVFNPGALELLVSVMGEDRVMLGSDYPFPLGEQKIGG---------------------LVLSSNLGESAKDKIISGNASKFFN 331
49 -13.8002wm1_A mol:protein length:336 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECA  ali model follow..  2..................KIDIHSHIL-GEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTQALSTVPVMFSAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELA---VKEMERCVKELGFPGVQIGTHVNEWDLNAQE---LFPVYAAAERLKCSLFVHPWDMQMDGRMLVGMPAETTIAICSMIMGGVEKFPKLKVC--FAHGGGAFPFKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIE--------------------SMEEFDEETKNKLKAGNALAFLG 329
50 -13.6003qy8_A mol:protein length:251 Tyrosine-protein phosphatase CpsB  ali model follow..  14  1..................MIDIHSHIV----------FDVDDGPKSREESKALLAESYRQGVRTIVETPEEKIAENFLQVREIAKEVASDLVIAYGAEIY-----------TPDVLDKLEKKRIPTLNDS-------RYALIEFSMNTPYRDIHSALSKILMLGITPVIAHIER-------------------------YDALENNEKRVRELIDMGCYTQVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVIASDMHNLDGRPPHMAEAYD------------------LVTQKYGEAKAQELFIDNPRKIVM 239
51 -12.7002ogj_A mol:protein length:417 Dihydroorotase  ali model follow..  13  42GDGKIAAVGSALQAPA-GWVDLHVHIW----------------HGGTDISIRPSECGAERGVTTLVDAGSAGEANFHGFREYIIEPSRERIKAFLNLGSIGLVACNRVP-ELRDIKDIDLDRILECYAENSEHIVGLKVRASHVITGSWGVTPVKLGKKIAKILKVPMMVHVGEPPALYDEVLEILGPGDVVTHCF--SSIMEDEDLNLAERCAGEGIRLDIG------HGGASFSFKVAEAAIARGLLP-FSISTDLHGHSM------------------VWDLATTMSKLLSVDMPFENVVEAVTRNPASVIR 334
52 -12.0002imr_A mol:protein length:420 Hypothetical protein DR_0824  ali model follow..  11  94.................PPVNAHTHLDMSAYEFQALP---GRHLRGVAAAQAGADTLTRLGAGGVGDIVWA-----PEVMDALLAREDLSGTLYFEV----------LNPFPDKADEVFAAARTHLERWRRLERPGLRLGLSPHTPFTVSHRLMRLLSDYAAGEGLPLQIHVAEHPTEDLTPVRYLDELGVLAARPTLVHMVNVTPDD-IARVARAGCAVVTCPRSNHHLECG---TFDWPAFAAAG---EVALGTD----------------SVASGETLNVREEVTFARQLYPGLDPRVLVRAAVKGGQRVVG 396
53 -11.9002ics_A mol:protein length:379 Adenine Deaminase  ali model follow..  14  27..KKIAAVAATISGSA-GWIDDHVHCFEKMALYYDYPD----------------EIGVKKGVTTVIDAGTTGA-ENIHEFYDLAQQAKTNVFGLVNISKWGIVAQDELADLSKVQASLVKKAIQELPDFVGIKARMSRTVIGDNGITPLE----LAKQIQQENQEIPLMVHIGSAPPHLDEILALMEKGDVLTHCFNILDQATDKIKDFAWQAYNKGVVFDIG------HGTDSFNFHVAETALREGMK---SISTDIY--------------IRNRENGPVYDLATTMEKLRVVGYDWPEIIEKVTKAPAENFH 316
54 -11.7003dc8_A mol:protein length:490 Dihydropyrimidinase  ali model follow..  26..GRIVEIGPNLSGAETGGIDPHTHLEMPFMGTYSS-----------DDFESGTRAALAGGTTMVVDFALPSPGQSLLEALTMWDNKSTRANCDYSFH-----------MAITWWGEQVFNEMETIVKDKGINT--FKHFMAYKGALMVDDDEMFSSFQRCAALGALPLVHAENGDVVAQLQAKLLAEGNSGPEPVYIVHTSCEQAHEAIRRARAKGMRVFGEPLIQHLTLDETLHQDSLWAGLASGSLQVVATDHCAFTTEQKRFGVGDFTRIPNGTGGLEDRMPMLWTYGVATGITMNEFVAVTSTNIAKILN 374
55 -11.7002vr2_A mol:protein length:541 DIHYDROPYRIMIDINASE  ali model follow..  46..GVVRALGHDLLPPG-GGIDTHTHMQFPFMGS-----------RSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLEAFETWRSWADPKVCCDYSLH-----------VAVTWWSDQVKEEMKILVQDKGVNS--FKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGMDENRFVAVTSTNAAKIFN 403
56 -11.7001kcx_A mol:protein length:518 DIHYDROPYRIMIDINASE RELATED PROTEIN-1  ali model follow..  12  33..GLIKQIGENLIVPG-GGIDVNTYLQKPSQGM-----------TSADDFFQGTKAALAGGTTMIIDHVVPEPGSSLTSFEKWHEAADTKSCCDYSLH-----------VDITSWYDGVREELEVLVQDKGVNS--FQVYMAYKDLYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGMDENQFVAVTSTNAAKIFN 386
57 -11.7003qy6_A mol:protein length:262 Tyrosine-protein phosphatase YwqE  ali model follow..  12  1..................MIDIHCHILPAMD----------DGAGDSADSIEMARAAVRQGIRTIIKNEPAAVREAADQLNKRLIKEDIPLHVLPGQEIR-----------YGEVEQDLAKRQLLSLNDTKY-------ILIEFPFDHVPRYAEQLFYDLQLKGYIPVIAHPER-------------------------NREIRENPSLLYHLVEKGAASQITSGSLAGIFGKQLK-AFSLRLVEANLIH--FVASDAHNVKTRNFHTQEALYVLEKEFG-------------------SELPYMLTENAELLLR 233
58 -11.4002gse_A mol:protein length:501 Dihydropyrimidinase-related protein 2  ali model follow..  10  45..GLIKQIGENLIVPG-GGIDVHTRFQMPDQGMTSA-----------DDFFQGTKAALAGGTTMIIDHVVPEPGTSLAAFDQWREWADSKSCCDYSLH-----------VDISEWHKGIQEEMEALVKDHGVNS--FLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGMDENQFVAVTSTNAAKVFN 398
59 -11.3001nfg_A mol:protein length:457 D-hydantoinase  ali model follow..  12  26..GKITQIGGALGPAE-GGIDVHTHV-----------ETVSFNTQSADTFATATVAAACGGTTTIVDFCQQDRGHSLEAVAKWDGMAGGKSAIDYGYHIIVLDPTDSVIEELEVLPD-------LGITS-------FKVFMAYRGMNMIDDVTLLKTLDKAVKTGSLVMVHAENGDAADYLRDKFVAEGKTAPIPIYIVHVTCEESLEEVMRAKSRGVRALAETCTHYLYLTKEKDHDVLWNALRNGVFE--TVSSD-LFKGHKDRGRNDFRAIPNGAPGVEERLMMVYQGVNEGRISLTQFVELVATRPAKVFG 374
60 -11.3002ftw_A mol:protein length:521 dihydropyrimidine amidohydrolase  ali model follow..  33..GIIKEISKNIEPKE-GGIDTHTHFQLPFMGT-----------VSVDDFDIGTQAAVAGGTTFIIDFVIPTRGQSLEAYDQWKKWADEKVNCDYSLH-----------VAITWWSEQVSREMEILVKERGVNS--FKCFMAYKNSFMVTDQEMYHIFKRCKELGAIAQVHAENGDMVFEGQKKMLEMGITGPEPVYIVHVQSIGAADVICKHRKEGVRVYGEPIAAGLGVDGSRTKGVLMDYLARGDLDCVGTDNCTFCADQKAMGKDDFTKIPNGVNGVEDRMSIVWENGVNTGLTWCQFVRATSSERARIFN 386
61 -11.1002vun_A mol:protein length:386 ENAMIDASE  ali model follow..  49..ATIIDAAGST-----GLLDTHVHVSGGD-------------YAPRQKTMDFISSALHGGVTTMISAG------SPHFPGRPKDAAGTKALAITLVKVHGGAVILEKGLTEEDFIEMKKEGVW-IVGEVGLGT--------------KNPEDAAPMVEWAHKHGFKVQMHTGGTSIPGSSTVTADDVIKTKPDVVSINGGPTAISVQEVDRIMDETDFA----MEIVQCGNPKIADYVARRAAEKGQLGRVIFGNDAPSGTGLIPLG---------------ILRNMCQIASMSDIDPEVAVCMATGNSTAVYG 319
62 -11.1001j79_A mol:protein length:347 dihydroorotase  ali model follow..  10  11.................RPDDWHLHL------------------RDGDMLKTVVPYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAPHDFTPLMTCY--TDSLDPNELERGFNEGVFTAAKLYP------ANATTNSSHGVTSVDAIMPVLERMEKIGMPLLVHGEVREARFIESVMEPLRQRLTALKVVFEHITTKDAADYVRTITPQHLMFNRNHMLVGGVRPRNIHQQALRELVASGFQR-VFLGTD---SAPHARHRKESSCGCAGCFNAPTALGSYATVFEEMN-ALQHFEAFCSVNGPQFYG 304
63 -10.9003pnu_A mol:protein length:359 Dihydroorotase  ali model follow..  12  10..ENLYFQSNAMKLK--NPLDMHLHL---------------------NQMLELIAPLSARDFCAAVIMPNL---IPPLCNLEDLKAYKMRILKACKDENFTPLMTLFFKNYDEKFLYSAKDEIFIKLYPAGI------TTNSNGGVSSFDIEYLKPTLEAMSDLNIPLLVHGETNDDRESNFAKIYEKLAKHFPKIVMEHITTKTLCELLKDYENLYATITLHHLIITLDAKRYEDKEALCELAFSGYEK-VMFGSD---SAPHPKDTKECCGCAAGVFSAPVILPVLAELFKQNS-SEENLQKFLSDNTCKIYD 309
64 -10.9003hpa_A mol:protein length:479 AMIDOHYDROLASE  ali model follow..  12  88.................GLVNTHHHMYQSLTRAVPAAQNALTPEMIEVSTLTAMAELLQSGCTTSSDH-IYPNGSRLDDSIGAAQRIGMRFHASRGAMSVGQRDGGLPPDSVVEREPDILRDTQRLIETDEGRYAMLRVVVAPCSPFSVSRDLMRDAAVLAREYGVSLHTHLAENVNDGMTPAEYAEDLGWVGHDVWHAHCVQLDDAG-IGLFARTGTGVAHCPCSNMRLAS----IAPVKKMRLAG---PVGLGVD---------SASNDGAQMVAEVRQALLLQRV--GFGPDAMTAREALEIATLGGAKVLN 395
65 -10.9001k1d_A mol:protein length:460 D-hydantoinase  ali model follow..  12  26..GKIAMIGQNLEEKG-GGIDPHTHLDMPLGGTVTK-----------DDFESGTIAAAFGGTTTIIDFCLTNKGEPLKAIETWHNKANGKAVIDYGFH-----------LMISEITDDVLEELPKVLEEEGITS--LKVFMAYKNVFQADDGTLYCTLLAAKELGALVMVHAENGDVIDYLTKKALADGNTDPIQLYVVHVTCAQAVEKIAEARNKGLDVWGETCPQYLVLDQSWHQEVLWNALKNGQLQ--TLGSD-DFKGQKELGRGDFTKIPNGGPIIEDRVSILFSEGVKKGITLNQFVDIVSTRIAKLFG 377
66 -10.8001yny_A mol:protein length:461 D-Hydantoinase  ali model follow..  12  26..ERVVAIGHQLSVNG-GGIDPHTHLDMPFGGTVTA-----------DDFFTGTRAAAFGGTTSIVDFCLTKKGESLSAIATWHEKARGKAVIDYGFH--------IAEANDQVLEELESVISSEGITS-------LKVFMAYKNVFQADDETLFKTLVKAKELGALVQVHAENGDVLDYLTKKALAEGNTDPIQLYVVHVSCASAVQRIAEAREKGWNVYGETCPQYLALDVSWNQEVLWSALKNGILQ--TVGSD-NFRGQKELGRGDFTKIPNGGPLIEDRLTILYSEGVRQGISLNQFVDISSTKAAKLFG 377
67 -10.7003e74_A mol:protein length:473 Allantoinase  ali model follow..  43..GKIAAIGQDLGDAK-GMVDAHTHI-----------------RSHWEGYETGTRAAAKGGITTMIELNQLPATVDRASIELKFDAAKGKLTIDAAQL--------LVSYNIDRLHEL----DEVGVVGFKCFVATCGDRGIDNDFRDVNDWQFFKGAQKLGELGQPVLVHCENALEAIRRVLYLAKVAGC---RLHVCHVSSPEGVEEVTRARQEGQDITCESCPHYFVLDTDENQKGMWEKLFNGEID--CLVSD-HSPCPPEMKAGNIMKAWGGIAGLQSCMDVMFDEAVQKRMSLPMFGKLMATNAADIFG 388
68 -10.6001gkp_A mol:protein length:458 HYDANTOINASE  ali model follow..  12  25..ETITRIGQNLEAPP-GFIDPHVHIYLPFMATFAK-----------DTHETGSKAALMGGTTTYIEMCCPSRNDDLEGYQLWKSKAEGNSYCDYTFHMAVSKFDEKTEGQLREIVA-------DGISS-------FKIFLSYKNFFGVDDGEMYQTLRLAKELGVIVTAHCENAEEGTARFATFLETTGAT---GYVVHLSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTRNQKVLWDALAQGFIDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGLDIHRFVDAASTKAAKLFG 375
69 -10.4002uz9_A mol:protein length:476 GUANINE DEAMINASE  ali model follow..  10  93.................GLVDTHIHLLEWLTKYTFPAEHRFQNIDFAEEVYTRVRRTLKNGTTTACYFATI--TDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKE--TERFVSEMLQKN--YSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEYKNYTSVYDKNNLLTNKTVMAHGCYLSAEE-LNVFHERGASIAHCPNSNLSLSSG---FLNVLEVLKHE---KIGLGTDVA........................................................ 348
70 -10.4003ls9_A mol:protein length:456 Triazine hydrolase  ali model follow..  15  58.................GLINSHQHLYEGAMRAIPQLERVFGPDVIREVARAVLLESLLGGITTVADQPGATADSYIDATIEAATDLGIRFHAARSSMTLGKSEGGFCDDLFVEPVDRVVQHCLGLIDQEPEPFGMVRIALGPCGVPYDKPELFEAFAQMAADYDVRLHTHFYEPLDAGMTPWRFLEKHGWASDRVWLAHAVVPPREE-IPEFADAGVAIAHLIAPDLRMGWG---LAPIREYLDAG---TVGFGTT-------GSASNDGGNLLGDLRLAALAHRPADPNEPEKWLSARELLRMATRGSAECLG 376
71 -10.4001gkr_A mol:protein length:458 NON-ATP DEPENDENT L-SELECTIVE HYDANTOINASE  ali model follow..  12  27..GKVAAISADTSDVE-GVVDEHVHI---------IDMDLKNRYGRFELDS---ESAAVGGITTIIEMPITFPPTTLDAFLEKKKQAGQRLKVDFALY--------GVPGNLPEIRKMHDAGA------VGFKSMMA--ASVPGMFDAVSDGELFEIFQEIAACGSVIVVHAENETEAIQRALLLQKEAGC---RLIVLHVSNPDGVELIHQAQSEGQDVHCESGPQYLNITTDEMNIRLWEQLENGLIDTLGSDHGGHPVEDKEPGWKDVWKAGNGALGLETSLPMMLTNGVNKGLSLERLVEVMCEKPAKLFG 373
72 -10.3003hm7_A mol:protein length:448 Allantoinase  ali model follow..  12  60.................GMVDVHVHF-----------------RTEWEGFASGSKSLAAGGVTTYFDMPLNSNPPTREELDKKRQLANEKSLVDYRFW--------LVPGNIDHLQDLHDGGV------IGFKAFMS--ECGTDDFQFSHDETLLKGMKKIAALGSILAVHAESNEEAVERILRFAQLTCC---PIHICHVSSRKVLKRIKQAKGEGVNVSVETCPHYLLFSLDQEVEDLWDGLMAGEID--LISSDHSPSLPQMKTGKTIFEVWGGIAGCQNTLAVMLTEGYHKRMPLTQIVQLLSTEPAKRFG 376
73 -10.3002z2b_A mol:protein length:337 Dihydroorotase  ali model follow..  1..........TAPSQVLRPDDWHLHL------------------RDGDMLKTVVPYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQR--ILDAVPAGHDFTPLMTCYLTDSLDPNELERGFNE---------------GVFTAAKLYPATSVDAIMPVLERMEKIGMPLLVHGEDREARFIESVMEPLRQRLTALKVVFEHITTKDAADYVRTITPQHLMFNRNHMLVGGVRPRNIHQQALRELVASGFNR-VFLGTD---SAPHARHRKESSCGCAGCFNAPTALGSYATVFEEMN-ALQHFEAFCSVNGPQFYG 294
74 -10.3002gok_A mol:protein length:429 Imidazolonepropionase  ali model follow..  12  81.................ALIDCHTHLVFGGNRAMEFETRALSDEVLVAQALPRLDTLLSEGVSTIEIKSGYGLDKMLRVARRLETLRPVRIVTSLAAHATPADYKGRNADYITDVVLPGLEKAH--------AEGLADAVDGFCEGIAFSVKEIDRVFAAAQQRGLPVKLHAEQLSNLGGAEL------AASYNALSADHLEYLDETG-AKALAKAGTVAVL--LPGAFYALREKQLPPVQALRDAG---EIALATDCN----------------PGTSPLTSLLLTMNMGATLFRMTVEECLTATTRNAAKALG 373
75 -10.3002qs8_A mol:protein length:418 Xaa-Pro Dipeptidase  ali model follow..  12  64.................GLMDMHVHFGQEYQSKAQAPIKVEREMQAI-LATQHAYVTFKSGFTTVRQVG--DSGLVAISLRDAINSGKLKTIATTGGHADPTNGKAVDDYGPYEVYAAVRQRYKDGADGIKITVGGVLSVAKSGQNPQFTQEEVDAVVSAAKDYGMWVAVHAH-----GAEGMKRAIKAGVD----SIEHGTFMDL-EAMDLMIENGTYYVPTISAGEFVAEKPQISDTFRKAYEKG---KIAFGTDAGVQKHGTNWKE-------------------FVYMVENGMPAMKAIQSATMETAKLLR 367

FFAS is supported by the NIH grant R01-GM087218-01
5 9 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.