current user: public




Query: 3Q8J Entity 1(prereleased), from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .
# Score Template Links and tools%idFirst XGCAFEGESCNVQFYPCCPGLGLTCIPGNPDGTCYYLLast
1 -36.5003Q8J Entity 1(prereleased)  ali  102  1XGCAFEGESCNVQFYPCCPGLGLTCIPGNPDGTCYYL 37
2 -6.7001wqb_A mol:protein length:32 Aptotoxin VII  ali model follow..  36  2LGCARVKEACGPWEWPCCSGLKCDGSECHPQ...... 32
3 -6.4703izs_Z mol:protein length:155 60S ribosomal protein rpL24 (L24e)  ali model follow..  19  1....MKVEIDSFSGAKIYPGRGTLFVRG--DSKIFRF 31
4 -6.2504a17_T mol:protein length:158 RPL24  ali model follow..  25  2...VVRTGTCSFCEYRIYPGRGQRFI--AKDGRGFFF 33
5 -6.2003izr_Z mol:protein length:162 60S ribosomal protein L24 (L24e)  ali model follow..  21  2...VLKTELCRFSGQKIYPGKGIRFI--RADSQVFLF 33
6 -6.1902zkr_u mol:protein length:157 60S Ribosomal protein L24  ali model follow..  25  1....MKVELCSFSGYKIYPGHGRRYA--RTDGKVFQF 31
7 -5.9802c9l_Y mol:protein length:63 BZLF1 TRANS-ACTIVATOR PROTEIN  ali model follow..  28  35...SSENDRLRLLLKQMCPSLDVSIIPRTPD...... 63
8 -5.6102c9n_Y mol:protein length:63 BZLF1 TRANS-ACTIVATOR PROTEIN  ali model follow..  28  35...SSENDRLRLLLKQMCPSLDVSIIPRTPD...... 63
9 -5.6001iva_A mol:protein length:48 OMEGA-AGATOXIN-IVA  ali model follow..  27  3KCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCEC... 36
10 -5.5202h1z_A mol:protein length:39 Hybrid atracotoxin  ali model follow..  25  1GSCVPVDQPCSLNTQPCCDDATCTQERNENGHTVYY. 36

FFAS is supported by the NIH grant R01-GM087218-01
4 8 1 4 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Igarashi Y, Eroshkin A, Gramatikova S, Gramatikoff K, Zhang Y, Smith JW,Osterman AL, Godzik A. CutDB: a proteolytic event database. Nucleic Acids Res. 2007 Jan;35(Database issue):D546-9. Epub 2006 Nov 16.