current user: public




2wlcA
Query: 2wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MGTHMYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFYKLast
1 -84.6002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model  100  1MGTHMYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFYK 215
2 -62.3003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  30  34......DDNGSGNVFVCGDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKG-DIVATKGSKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPS-MCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHA 240
3 -61.9001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  18  2..NMPMTERIRAGKLFTDMCE-----GLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGENAWVEPPVYFSYGSNIHGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLS-VTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPP-NVVAAGVPCRVIREINDRDKHYYFKDYKVESSV..... 203
4 -60.7003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  15  2.NAMTEKEKMLAEKWYDAN----FDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFY-TATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPP-HSLAVGNPCKVVRKIDNDLPSETLNDETIK........ 202
5 -58.4003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  21  2.NAMTEKEKMLSGKGYYANDE-----LLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGSVGKQINVEQNIRCDYGYNIHGENFFANYDCIFLDVCKIEIGDNVMLAPNVQIY-TAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPP-NTVAVGNPCRVIKKIEE..................... 188
6 -57.9003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  15  3AMKMSELEKMLKGEHFDGASA-----EIEALRSQAGRLKLEINQSLDEA--ERYALQRELFGHLGHKSCVQPPFHCEFGKTIRGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFY-TASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPP-DTLVGGTPARILRSLKDPAESMAE.............. 195
7 -57.9002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  21  1..MKSEKEKMLAGHLYNPADL-----ELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIY-TATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPA-NAVVGGNPAKVIKWL....................... 184
8 -56.7003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  23  3.AMKTEKDKMLAGEMYIADDE-----ELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSSADKAQINPDFRCDYGYNIHGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIY-TATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPN-NVVVGGNPAKVIKTIEE..................... 190
9 -56.4001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  27  1...STEKEKMIAGELYRSADE-----TLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEAY-IEPTFRCDYGYNIFGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIY-TATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPD-NVVVGGNPARIIKKL....................... 182
10 -41.8001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  21  1.....................................MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPI---LNDKLKIGKFCSIGPGVTIINGANHRMDHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIA-PYMLAGGNPANEIKQRFDQDTINQLLDIK.......... 180
11 -39.5003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  25  113...................................................................................MMNATINIGAVIGEGSMITVGKNCHVGAGAVL-AGVIEP----------PSAKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVP-PYTVVAGTPARVIKEIDEKTKAKTE.............. 228
12 -39.2001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  18  41....................................................................................DDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIGNQGHRAEWASTVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVE-PYAIVGGNPARTIRKRFSDG................... 168
13 -39.0003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  13  62............................................................................SGKVTIGSYSHIAAYTALYGGEVGIEMYDFANISSRTIVY-AAIDDFSGIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLD-DWYIYVGVPVRKIKARKRKIVELENEFLKSMNS...... 199
14 -38.3003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  18  62...................EANKEKIEDYVVENDARNSAIPFLDLKDINARIEPGALIREKVEIGDQAVIMMGAILNIGAVV-GAGTMIDMGAVLGGR--ATVGKHCHIGAGTVL-AGVIEPPS----------AAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVP-AHTVVAGVPAKVIKQIDDKTKSKT............... 227
15 -37.8003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  26  55................................................................................................DVDKLVIGSFCSIGSGAVFMGNQGHRSDWISTRDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVA-PYEVVGSNPAKHIKFRFSDV................... 169
16 -32.3003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  10  101......................LKKAVLLSFRLEDNAPMPAGGYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKNVVYTNIGAYVDEGTMVTVGSCAQIGKNVHLSGGVG-----IGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKI-YDRETGEVTYGRIP........................ 271
17 -29.7002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  14  235..............................................................................GTTIMPGASYVNFNAGTTGACMVRISSSAIVGEGSDV-GGGASILGVLSGTS----GNAISVGKACLLGANSVT--GIPLGDNCIVDAGIAVLEGTKF-LLKDAEELAKLNPYFNFDKEIYKGLELKGLNGL..... 360
18 -29.6002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  19  87.........................................................................ISPSAIVEENAGILIMPYVVI---NAKAKIEKGVILNTSSVI-EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDE-KGVFVGVPAKRMEGGS...................... 201
19 -29.0003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  17  55...................................................................................GNRVKIQNNVSVYDN--VFLEDDVFCGPSM-VFTNVYNPRAAIERKSEY---RDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPD-FALVVGVPARQIGWMSRHGEQ................. 162
20 -29.0003r5a_A mol:protein length:347 Tetrahydrodipicolinate N-succinyletransferase  ali model follow..  13  166................................................EVFSVDKFPKMTDYVVPAGVRIADTARVRLGAYIGEGTTFVNFNAGTEGPGMIEVSAGVFVGKGSDL-GGGCSTMGTLSGGG----NIVISVGEGCLIGANAGI--GIPLGDRNIVEAGLYITAGTKVALLDEQNALVKVVKA........................ 308
21 -28.0003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  19  88.........................................................................ISPSAIVEENAGILIMPYVVI---NAKAKIEKGVILNTSSVI-EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDE-KGVFVGVPAKRM.......................... 198
22 -27.5003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  12  164.....................................................................IADADRVRLGAHLAPGTTFVNYNAGTLGASMVEISAGVVVGDGSDV-GGGASIMGTLSGGG----THVISIGKRCLLGANSGL--GISLGDDCVVEAGLYVTAGTRV-TMPDSNSVKA--RELSGSSNLLFRRNS........... 295
23 -24.7003fs8_A mol:protein length:273 QdtC  ali model follow..  16  106..............................................................................NTKIGNNVKIGTLSDI---QHHVYIGNYVNIHSNVFVGEKFPHVVLTNDPTPPSNELLGVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPK-ETVVVGNPAREICS........................ 223
24 -23.9003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  16  29...............................................................................VVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSPNNPLIIEDGVTVGHQVHSAIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPPGKKPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYYK 167
25 -23.8001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  16  31...............................................................................VYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQYPLILEDDVTVGHQVHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKPPNTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYYK 169
26 -23.5001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  18  29...............................................................................VVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPTEIGEYVTIGHNAHGAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHI 167
27 -23.2003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  17  38...............................................................................VELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGSVLHITHASDYNPGGYPLIIGDDVTITIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSPG--ESGFVYMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHL 183
28 -23.1003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  14  46...............................................................................VCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTDSMHGDTVIGKFVTIGHSCILTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRG--KSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGY. 184
29 -23.0003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  17  34...............................................................................VRLADDVGIWPLVVIRGDVNYVAIGARTNIQDGSVLHVTHKSSSNPHGNPLIIGEDVTVTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPQH--ESGYLYLGSPVKQIRPLSDAERSGLQYSANNYVKWKDDYL 179
30 -22.3001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  17  136.............................................................................FDVDIHPAAKIGH-GIMFDHATGIVVGETSVIENDVSIL----QGVTLGGTGKESGDRHP-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVP-EYATAAGVPARIVSQ........................ 242
31 -22.2001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  17  138.............................................................................FDVDIHPAAKIGH-GIMFDHATGIVVGETSVIENDVSIL----QGVTLGGTGKESGDRHP-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVP-EYATAAGVPARIVSQ........................ 244
32 -22.0003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  19  157.............................................................................FQTDIHPAARLGS-GLFLDHATGLVVGETAVVEDNVSIL----HGVTLGGTGKSSGDRHP-KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVP-HNVTVAGVPARIIGE........................ 263
33 -21.9003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  21  143.............................................................................FGVDIHPAATIGC-GIMLDHATGIVIGETAVVENDVSIL----QSVTLGGTGKTSGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVP-AHTTAAGVPARIVGK........................ 249
34 -21.8003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  20  156...................................................................................DKGAMIDTWATVGSCAQI--GKNVHLSGGVGIGGVLEPM------------AGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATG-VPPYSV.......................... 253
35 -21.7001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  19  150.............................................................................FQVDIHPAAKIGR-GIMLDHATGIVVGETAVIENDVSIL----QSVTLGGTGKSGGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVP-PHTTAAGVPARIVGK........................ 256
36 -20.7003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  14  52...............................................................................VRIKDYVHIAPGTSIRADEGTFHIGSRTNIQDGVVI-----HGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQ 207
37 -20.3003TV0 Entity 1(prereleased)  ali follow..  19  30..............................................................................DVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTED---PEPKPMIIGTNN-IESKAYVGRNVILTSGCIIGACCNLNTF--PENTVIYGADCLRRVQTER..................... 160
38 -20.3003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  14  164.............................................................................TSIDIHPGASIKG-HFFIDHGVGVVIGETAIIGEWCRIYTLGAMHFQEEGGVIKRGTKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVYSEHPTHFVKP........................ 280
39 -20.1001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  16  129............................................................................NIGAYVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGIGGV---------------QANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETG-YCAVIVKKVDAKTRGK................ 263
40 -19.7003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  14  131............................................................................NIGAFVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGIGGV---------------QANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPA........................ 231
41 -19.5003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  19  189.............................................................................TGIDIHPGAQIGH-HFTIDHGTGVVIGATSIIGNNVKLYTLGAKSFPLDNNGNPIKGIPR-ILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVP-AGSRIVQRKNKDELE........................ 304
42 -19.3003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  14  134............................................................................NIGAYVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGIGGV---------------QANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPA........................ 234
43 -18.7001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  14  61................................................................................VIDPTAYIDPQASVI---GEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEG 242
44 -15.7001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  21  50............................TFVGKNTEIFPFAVLGTQPQDLKYKGEYSELIIGEDNL---IREFCMINPGTEGGIKKTLIGDKNLLMAYVHVVIGSHCILANGVTL---AGH----------------IEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVP-PYCTVEGNRAFIRGLNRHRMRQLLESK............ 205
45 -15.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  18  56............................TKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVT---HRGTVQGGGLTKVGSDNLLM---INAHIAHDCTVGNRCIL-------------ANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVP-PYVIAQGNHATP........................... 196
46 -14.4003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  17  53............................TTIGDHSRVFSYAIVGDIPQDISYKEEQKSGVVIGKNATIREFATINSGTAKG-DGFTRIGDNAFIM---AYCHIAHDCLLGNNIIL-------------ANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIV-PFCLAEGNRASIRSLNLVGIRRRFDKD............ 209
47 -14.3003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  15  49............................SEIGKFNRFHQGAVIGVMPQDLGFNQQLTKTVIGDHNI---FREYSNIHKGTKEDSPTVIGNKNYFM---GNSHVGHDCILGNNNIL-------------THGAVLAGHVTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVP-PYSTVDGNPSTV........................... 189
48 -14.3003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  25  216.........................................................GVTIGDDVEIGANTTIDRGALSDTLIGNGVKLDNQIMIAH--NVQIGDHTAMAACVGI-------------------SGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITEPGSYSSGTAMQPAAE........................ 328
49 -14.0003eh0_A mol:protein length:341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  21  200.........................................................RVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAH--NVVIGDNTAVAGGVIM-------------------AGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKV........................ 312
50 -13.9002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  29  283.................................................................................LVEKNKIGASESVIMEGSKIVIAEDVNFGAGTLILRFDEKEVKVNVKGKRISSGRRAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFFKV................................. 401
51 -13.2003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  18  381..................................................................................................GDADIGEYSNIGASSVFVNYDG------------TSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIE......................... 460
52 -12.7002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  25  222.........................................................KVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNLVQIAH--QVEVGQHSMIVAQAGI-------------------AGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIY-GGAPARPYQE........................ 333
53 -12.6001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  22  370..................................................................................................GNCEVGSNVNFGAGTITVNYDG------------KNKYKTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKD......................... 449
54 -12.5001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  23  367..................................................................................................GNCEVGSNVNFGAGTITVNYDG------------KNKYKTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKD......................... 446
55 -12.5001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  20  368..................................................................................................GDAEIGDNVNIGAGTITCNYDG------------ANKFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKE......................... 447
56 -12.5002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  23  368..................................................................................................GDSEIGSNCNIGAGVITCNYDG------------ANKFKTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELVITRVAQRHIQ......................... 447
57 -12.5003fww_A mol:protein length:456 Bifunctional protein glmU  ali model follow..  22  368..................................................................................................GDAEIGAGVNIGAGTITCNYDG------------ANKFKTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVHIQ......................... 447
58 -11.8003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  16  285..............................................................................DTVIGENVLVSQR----AYLDNAWMGKGSNAQENCYIINSRLERNCVTAHGGKI----NAHLGDMIFTGFNSFLSSPLKIGDGCVVMPHTIIDLEIPAGHLVWG................................. 389

FFAS is supported by the NIH grant R01-GM087218-01
5 9 8 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.