current user: public




Query: 2wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MGTHMYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFYKLast
1 -84.6002wlc_A mol:protein length:215 POLYSIALIC ACID O-ACETYLTRANSFERASE  ali model  100  1MGTHMYSEQGINNTINISTTSLTNATQLTVIGNNNSVYIGNNCKIVSSNIRLKGNNITLFIADDVEIMGLVCSLHSDCSLQIQAKTTMGNGEITIAEKGKISIGKDCMLAHGYEIRNTDMHPIYSLENGERINHGKDVIIGNHVWLGRNVTILKGVCIPNNVVVGSHTVLYKSFKEPNCVIAGSPAKIVKENIVWGRKMYHSTMYDDPTLNEFYK 215
2 -63.3003jqy_B mol:protein length:252 Polysialic acid O-acetyltransferase  ali model follow..  30  34......DDNGSGNVFVCGDLVNSKENKVQFNGNNNKLIIEDDVECRWLTVIFRGDNNYVRIHKNSKIKG-DIVATKGSKVIIGRRTTIGAGFEVVTDKCNVTIGHDCMIARDVILRASDGHPIFDIHSKKRINWAKDIIISSYVWVGRNVSIMKGVSVGSGSVIGYGSIVTKDVPS-MCAAAGNPAKIIKRNIIWARTDKAELISDDKRCSSYHA 240
3 -50.2001kqa_A mol:protein length:203 GALACTOSIDE O-ACETYLTRANSFERASE  ali model follow..  19  4.........PMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGENAWVEPPVYFSYGSNIHGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVT-GHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIP-PNVVAAGVPCRVIREINDRDKHYYFKDYKVESSV..... 203
4 -49.4003srt_A mol:protein length:188 Maltose O-acetyltransferase  ali model follow..  21  2......NAMTEKEKMLSGKGYYANDELLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGSVGKQINVEQNIRCDYGYNIHGENFFANYDCIFLDVCKIEIGDNVMLAPNVQIYTA-YHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPP-NTVAVGNPCRVIKK........................ 185
5 -49.2002ic7_A mol:protein length:185 Maltose transacetylase  ali model follow..  20  1.......MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTA-THPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPA-NAVVGGNPAKVIKW........................ 183
6 -49.0003v4e_A mol:protein length:202 Galactoside O-acetyltransferase  ali model follow..  16  21........................DQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTA-THPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPP-HSLAVGNPCKVVRKIDNDLPSETLNDETIK........ 202
7 -48.8004dcl_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  16  18........................DQTLINERLRAKVICFALNHTNPSATLKRKVLIDALFQTTTDNVSISIPFDTDYGWNVKGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTA-THPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPP-HSLAVGNPCKVVRKIDNDLPSETLNDETIKLE...... 201
8 -48.7004egg_A mol:protein length:207 Putative acetyltransferase SACOL2570  ali model follow..  16  18........................DQTLINERLRAKVICFALNHTNPVATMMRKVLIDALFQTTTDNVSISIPFDTDYGWNVKGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFY-TATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPP-HSLAVGNPCKVVRKIDNDLPSETLNDETIKLE...... 201
9 -47.8001ocx_A mol:protein length:182 MALTOSE O-ACETYLTRANSFERASE  ali model follow..  25  1........STEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEAY-IEPTFRCDYGYNIFGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTA-THPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPD-NVVVGGNPARIIKK........................ 181
10 -47.4003hjj_A mol:protein length:190 Maltose O-acetyltransferase  ali model follow..  22  3......AMKTEKDKMLAGEMYIADDEELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSSADKAQINPDFRCDYGYNIHGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIYTA-THPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPN-NVVVGGNPAKVIKT........................ 187
11 -46.8003ect_A mol:protein length:195 Hexapeptide-repeat containing-acetyltransfera  ali model follow..  14  1...SNAMKMSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEA---RYALQRELFGHLGHKSCVQPPFHCEFGKTIRGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFY-TASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPP-DTLVGGTPARILRSLKDPAESMAE.............. 195
12 -34.4003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  14  23..........................KIGFLSVGKNVLISKKASIYNPGVISIGNNVRI-----------DDFCILSGKVTIGSYSHIAAYTALYGGEVGIEMYDFANISSRTIVYAAIDDFSGNALMGPTIPKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLD-DWYIYVGVPVRKIKARKRKIVELENEFLKSMNS...... 199
13 -29.9003eev_A mol:protein length:212 Chloramphenicol acetyltransferase  ali model follow..  22  21...........................................................................TNPNIIVGKHSYYSGYY-ERDDVDKLVIGSFCSIGSGAVFMGNQGHRSDWISTRDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVA-PYEVVGSNPAKHIKF........................ 164
14 -29.8001khr_A mol:protein length:209 STREPTOGRAMIN A ACETYLTRANSFERASE  ali model follow..  25  11............................................................IEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQKLKIGKFCSIGPGVTIMNGANHRMDGSTKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIA-PYMLAGGNPANEIKQ........................ 166
15 -29.8001xat_A mol:protein length:212 XENOBIOTIC ACETYLTRANSFERASE  ali model follow..  18  19...........................................................................SNPNIRVGRYSYYSGYY-DRDDVDKLVIGSFCSIGSGAAFIGNQGHRAEWASTVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVE-PYAIVGGNPARTIRK........................ 163
16 -29.4004hur_A mol:protein length:220 Virginiamycin A acetyltransferase  ali model follow..  25  32...........................................................................TNENILVGEYSYYDSKRGESFEDQKLIIGRFCSIGPGTTIMNGANHRMKYMPSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVA-PYSIVGGNPLKFIRK........................ 172
17 -23.4003vnp_A mol:protein length:183 Hypothetical conserved protein  ali model follow..  17  29...............................................................................VVIGEETSIWFNTVIRGDVAPTVIGNRVNIQDNSILHQSPNNPLI----EDGVTVGHQVIVRKNALIGMGSIILDRAEIGEGAFIGAGSLVPPGKKPPNTLALGRPAKVVRELTEDDIREMERIRREYVEKGQYYK 167
18 -23.2003fs8_A mol:protein length:273 QdtC  ali model follow..  16  106..............................................................................NTKIGNNVKIGTLSDI---QHHVYIGNYVNIHSNVFVGEKFPHVVLTNDPTPPSNELLGVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPK-ETVVVGNPAREICS........................ 223
19 -23.1004mfg_A mol:protein length:168 Putative acyltransferase  ali model follow..  18  31...............................................................................VKIGKDSSIWYNAVVRGDEGPITIGENTNIQDCSIVHGDTETIIGNNVTVGHRSIVHGCKISDNVLIGMGSIILDNAEIGEYTLIGAGTLITSNKKPPGVLIMGSPGKVVRELTEEDKKYIDESYEWYLEAAQNQK 167
20 -23.1004ea7_A mol:protein length:220 Perosamine N-acetyltransferase  ali model follow..  16  54...........................VPVVGDDLALPMLREQGLSRLFVAIGDNRLRQKLGRKARDHGFSLVNAIHPSAVVSPSVRLGEGVAVMAGNADSWIGDLAIINTGAVV-DHDCRLGAACHLGPASALAGGVSVGERAFLGVGARVIPGVTIGADTIVGAGGVVVRDLPD-SVLAIGVPAKIKGDR....................... 219
21 -23.0001xhd_A mol:protein length:173 putative acetyltransferase/acyltransferase  ali model follow..  17  31...............................................................................VYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQYPLI----EDDVTVGHQVHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKPPNTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYYK 169
22 -22.4004m9c_A mol:protein length:216 Bacterial transferase hexapeptide (Three repe  ali model follow..  16  52.................................SYLDFISKPADHKAVTIAIANSVVREKLVSLLEKDGVQHLAVQSTNTVILDEVEIGEGSLLCPFTSNIKIGKFFHANIYSYV----AHDCV-VTFAPGAKCNGNIHIEDHAYIGTGAVIKQGLIIGKGAIVGMGAVVTKSVPA-GVTVVGNPARILERK....................... 216
23 -22.3001v3w_A mol:protein length:173 ferripyochelin binding protein  ali model follow..  19  29...............................................................................VVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIHTSHGYPTE----GEYVTIGHNAKVGNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEPDYSLVLGVPGKVVRQLTEEEIEWTKKNAEIYVELAEKHI 167
24 -22.0004n27_A mol:protein length:195 Bacterial transferase hexapeptide repeat  ali model follow..  15  44.........................................................KVVVGENAGFWFGAVLRGDNEPITIGADTNVQEQTIMHTDGFPLTIGAGCTIGHRAILH--------------------GCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKMEIPD-NSLVVGSPARVLRQLDDAAVEKLRASAKHYVERGHSFM 183
25 -21.6004m98_A mol:protein length:208 Pilin glycosylation protein  ali model follow..  13  46...........................FPVIGTTLLLENSLSPEQFDITVAVGNNRIRRQITENAAALGFKLPVLIHPDATVSPSAIIGQGSVVMAKQAGSVLKDGVIVNTAATV-DHDCLLDAFVHISPGAHLSGNTRIGEESRIGTGACSRQQTTVGSGVTAGAGAVIVCDIPD-GMTVAGNPAKPL.......................... 208
26 -21.6005adx_V mol:protein length:165 DYNACTIN SUBUNIT 6  ali model follow..  17  8......................................................................QSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPKGVAFFPLHIGDHVFIEEDCVIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT 163
27 -21.4002npo_A mol:protein length:207 Acetyltransferase  ali model follow..  19  87.........................................................................ISPSAIVEENAGILIMPYVVI---NAKAKIEKGVILNTSSVI-EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDE-KGVFVGVPAKRMEGG....................... 200
28 -21.2003ixc_A mol:protein length:191 Hexapeptide transferase family protein  ali model follow..  14  46...............................................................................VCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNTVVHTDSMHGDTVIGKFVTIGHSCILTLGNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTGKIVKSGELWAGRPAKFLRMMTEEEILYLQKSAENYIALSRGY. 184
29 -20.6003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  25  119............................................................................NIGAVIGEGSMIDMNAVL---GGRATVGKNCHVGAGAVL----AGVIEPPS-------AKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVP-PYTVVAGTPARVIKEIDEKTKAKT............... 227
30 -20.6003tio_A mol:protein length:183 Protein YrdA  ali model follow..  16  30...............................................................................VRLADDVGIWPLVVIRGDVHYVQIGARTNIQDGSMLHVT--HKSSYNPDGNPLTIGEDVTVGNRVLVGMGSILLDGAIVEDDVMIGAGSLVPNKRLESGYLYLGSPVKQIRPLSDEEKAGLRYSANNYVKWKDEYL 175
31 -20.4003r1w_A mol:protein length:189 carbonic anhydrase  ali model follow..  20  38...............................................................................VELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGSVLHIT--HASDYNPGGYPLIIGDDVTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSGKVLESGFVYMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHL 183
32 -20.3003r3r_A mol:protein length:187 ferripyochelin binding protein  ali model follow..  19  34...............................................................................VRLADDVGIWPLVVIRGDVNYVAIGARTNIQDGSVLHVT--HKSSSNPHGNPLIIGEDVTVGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPHKRLESGYLYLGSPVKQIRPLSDAERSGLQYSANNYVKWKDDY. 178
33 -20.3003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  25  119............................................................................NIGAVVGAGTMIDMGAVL---GGRATVGKHCHIGAGTVL----AGVIEPPS-------AAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVP-AHTVVAGVPAKVIKQIDDKTKSKT............... 227
34 -20.2003bss_A mol:protein length:198 Acetyltransferase  ali model follow..  19  88.........................................................................ISPSAIVEENAGILIMPYVVI---NAKAKIEKGVILNTSSVI-EHECVIGEFSHVSVGAKCAGNVKIGKNCFLGINSCVLPNLSLADDSILGGGATLVKNQDE-KGVFVGVPAKRM.......................... 198
35 -19.5004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  19  28..............................................................................GAVIGRNCNICANSLI---ENDVVIGDNVTIKSGVQIWDG---NDKQPRSKIYPDEYLKTIVKKGASIGANSTILPGILIGENAMVGAGAVITKNVP-DNAIVIGNPGRIT.......................... 147
36 -18.6003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransf  ali model follow..  18  33..............................................................................GAEIGEGCSLGQNVFV---GNRVRIGNRVKIQNNVSVYDN-TNVYNPRAAIERKSEYRDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPD-FALVVGVPARQI.......................... 153
37 -18.5003tv0_A mol:protein length:194 Dynactin subunit 6  ali model follow..  20  31...............................................................................VTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPD---NITPDTEDPEPKPMIIGTNN-IESKAYVGRNVILTSGCIIGACCNLNTEVIPENTVIYGADCL............................ 153
38 -18.3005adx_U mol:protein length:190 DYNACTIN 5  ali model follow..  19  27...............................................................................VTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPD---NITPDAEDSEPKPMIIGTNN-IESKAYVGRNVILTSGCIIGACCNLNTEVIPENTVIYGADCLRRVQ........................ 153
39 -18.2005afu_U mol:protein length:168 DYNACTIN  ali model follow..  19  15...............................................................................VTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINPDTEKPMIIGTNNVFEVGCYSKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTEVIPENTVIYGADCLR........................... 134
40 -18.2001ssq_A mol:protein length:267 Serine acetyltransferase  ali model follow..  17  120.............................................................NRKSLALYLQNQISVAFDVDIHPAAKIGHG-IMFDHATGIVVGETSVIENDVSIL----QGVTLGGTGKESGDRHP-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVP-EYATAAGVPARIV.......................... 240
41 -18.2001s80_A mol:protein length:278 Serine acetyltransferase  ali model follow..  17  122.............................................................NRKSLALYLQNQISVAFDVDIHPAAKIGHG-IMFDHATGIVVGETSVIENDVSIL----QGVTLGGTGKESGDRHP-KVREGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVP-EYATAAGVPARIV.......................... 242
42 -18.1003gvd_A mol:protein length:276 Serine acetyltransferase  ali model follow..  20  127.............................................................DRKALAIYLQNQVSVAFGVDIHPAATIGCG-IMLDHATGIVIGETAVVENDVSIL----QSVTLGGTGKTSGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVP-AHTTAAGVPARIV.......................... 247
43 -18.0004n69_A mol:protein length:286 Serine Acetyltransferase Apoenzyme  ali model follow..  20  135.............................................................SRRPLALALHSRIANVFAVDIHPAARIGKG-ILFDHATGVVVGETAVIGNNVSIL----HHVTLGGTGKVGGDRHP-KIGDGVLIGAGATILGNIKIGEGAKVGAGSVVLIDVP-PRTTAVGNPARLV.......................... 255
44 -18.0004hzd_A mol:protein length:282 CysE, serine acetyltransferase  ali model follow..  19  134.............................................................GRKDFAYYLQSRSSSIFQTDIHPAARLGSG-LFLDHATGLVVGETAVVEDNVSIL----HGVTLGGTGKSSGDRHP-KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVP-HNVTVAGVPARII.......................... 254
45 -17.9004h7o_A mol:protein length:281 Serine acetyltransferase  ali model follow..  20  124.............................................................GRKALATYFQNQISVACQVDIHPAARIGRG-IMLDHATGIVIGETAVVEDDVSIL----QDVTLGGTGKECGDRHP-KIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVP-PHTTVAGVPARIVGR........................ 246
46 -17.9003mc4_A mol:protein length:287 WW/Rsp5/WWP domain:Bacterial transferase hexa  ali model follow..  19  141.............................................................GRKDFAYYLQSRSSSIFQTDIHPAARLGSG-LFLDHATGLVVGETAVVEDNVSIL----HGVTLGGTGKSSGDRHP-KIRQGVLIGAGAKILGNIQVGQCSKIAAGSVVLKSVP-HNVTVAGVPARII.......................... 261
47 -17.9001t3d_A mol:protein length:289 Serine acetyltransferase  ali model follow..  18  134.............................................................GRRALAIFLQNQVSVTFQVDIHPAAKIGRG-IMLDHATGIVVGETAVIENDVSIL----QSVTLGGTGKSGGDRHP-KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVP-PHTTAAGVPARIVGK........................ 256
48 -17.5003kwc_A mol:protein length:229 Carbon dioxide concentrating mechanism protei  ali model follow..  16  52...............................................................................VRIKDYVHIAPGTSIRADGTPFHIGSRTNIQDGVVI-----HGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFNARVGAGCVVMGMVITTQQQ........................ 177
49 -16.1001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  19  29...........GDGVKLDEGVKLHNNVTTFVGKNTEIFPFAVLGTQPQDLKYKGEYSELIIGEDNLIREFCMTEGGIKKTLIGDKNLLMAYVHVAHD---CVIGSHCILANGVTL---AGH----------------IEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVP-PYCTVEGNRAFIRGLNRHRMRQLLESKD........... 206
50 -16.1001qq0_A mol:protein length:247 CARBONIC ANHYDRASE  ali model follow..  16  61................................................................................VIDPTAYIDPQASVI---GEVTIGANVMVSPMASIRSDEGMPIFNVQDGVVLHKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVN...... 236
51 -15.5004r36_A mol:protein length:275 Putative acyl-[acyl-carrier-protein]--UDP-N-a  ali model follow..  17  65...............................GNGNTIFPGAVIGAIPQDLKFKGEESTAEIGDNNENVTINRGTAAKGRTIVGNNNLLMEGVHVAHD---ALIGNGCIVGNSTKM-------------------AGEIIIDDNAIISANVLMHQFCRVGGYVMIQGGCRFSKDIP-PYIIAGREPIAYSGINIIGLRR................. 211
52 -15.2005dem_A mol:protein length:258 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  16  53.........GKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRG------------------TVQDRAETTIGDHNLIMAYAHIGHD---SVIGNHCILVNNTAL---AGH----------------VHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVP-AYVTVFGNPAEARSMNFEGMRR................. 200
53 -15.0002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUC  ali model follow..  16  35...........GPHVEIGEGTVLKSHVVTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTTVQGGGLTKVGSDNLLMINAHIAHD---CTVGNRCILANNATL---AGH----------------VSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVP-PYVIAQGNHATPFGVNIEGLKR................. 206
54 -14.9004e6t_A mol:protein length:294 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  22  82.........GQNNEIFQFASVGEVCQDLKYKGEETWLEIGNNNLIREHCSLHRG------------------TVQDNALTKIGSHNLLMVNTHIAHD---CIVGDHNIFANNVGV---AGH----------------VHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVP-AYVMASGNPAHAFGINIEGMRR................. 229
55 -14.8004eqy_A mol:protein length:283 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  15  44...........GSNVTIGARTTIGSHSVTTIGEDNRIGHYASVGGRPQDMKYKDEPTRLVIGDRNTIREFTTTVQDAGVTTLGDDNWIMAYVHIGHD---CRVGSHVVLSSNAQM---AGH----------------VEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIP-PFVIAAGNKAEPHGINVEGLRR................. 215
56 -14.6003p47_A mol:protein length:315 Serine acetyltransferase  ali model follow..  12  161..........................................................................HSYTSIDIHPGASIKG-HFFIDHGVGVVIGETAIIGEWCRIYTLGAMHFQEEGGVIKRGTKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVYISEHPTHFVK........................ 279
57 -14.5003t57_A mol:protein length:305 UDP-N-acetylglucosamine O-acyltransferase dom  ali model follow..  15  59.........GESCVLMTGAVVGDELPGYTFIGCNNIIGHHAVVGVKCQDLKYKGDECFLCIGNNNEFCSIHRSSKPSDKTVIGDNNLIMGSCHIAHD---CKIGDRNIFANNTLL---AGH----------------VVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVP-KYMMVAGERAELRGLNLEGLRR................. 228
58 -14.3003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  16  56...............................GDHSRVFSYAIVGDIPQDISYKEEQSGVVIGKNATIREFATTAKGDGFTRIGDNAFIMAYCHIAHD---CLLGNNIILANNATL---AGH----------------VELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIV-PFCLAEGNRASIRSLNLVGIRRRFDKDE........... 210
59 -14.0003f1x_A mol:protein length:310 Serine acetyltransferase  ali model follow..  18  186..........................................................................HSETGIDIHPGAQIGH-HFTIDHGTGVVIGATSIIGNNVKLYTLGAKSFPLDNNGNPIKIPRHPILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSRIVQRKNKDELE......................... 304
60 -13.7003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylgluc  ali model follow..  16  52...............................GKFNRFHQGAVIGVMPQDLGFNQQLTKTVIGDHNEYSNIHKGTKEDSPTVIGNKNYFMGNSHVGHD---CILGNNNILTHGAVL---AGH----------------VTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVP-PYSTVDGNPSTVVGLNSVGMKR................. 199
61 -12.8002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate t  ali model follow..  24  242.................................KGKVIIEEDAEIKSGTY-----EGPVYIGKGSEISYLRPYTILVEKNKIGASVEVKES--VIMEGSKIVIAEDVNFGAGTLILRFDEKEVKVNVKGKRISSGRRAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFFKV................................. 401
62 -12.0004e75_A mol:protein length:357 UDP-3-O-acylglucosamine N-acyltransferase  ali model follow..  16  209............................................................................GNDVRIGSNCSIDRGAL-TILEDGVIIDNLVQIAHNVHIGSNTA--------AAKCGIAGSTKIGKNCILAGACGVAGHLSIADNVTLTGMSMVTKNISEAGTYSSGTGLF---ENNHWKKTIVRLRQLADVPLTQITK 338
63 -11.4004ihf_A mol:protein length:348 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acy  ali model follow..  19  205............................................................................GDRVEIGACTTIDRGAL-TIIGNGVIIDNQCQIAANVVI---GDNTAVAGGVI----MAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKV---WRKTAA............... 319
64 -11.4002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-AC  ali model follow..  24  226............................................................................EDDVEIGANTTIDRGRFLVQIAHQVEVGQHSMIVAQAGI-------------------AGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPG-IYGGAPARPYQE........................ 333
65 -11.3003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  13  236......LVAGVNNRVQLAELASELNRRVVAA-LAGVTVVDPATTWIDVDVTIGRDTVIHVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAV---RPGTALGADGKLGAFVEVKNSTPH-VGDADIGEYSNIGRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASEM... 482
66 -11.3003pmo_A mol:protein length:372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac  ali model follow..  23  220............................................................................GDDVEIGANTTIDRGAL-TLIGNGVKLDNQIMIAHNVQI---GDHTAMAACVG-----SGSAKIGRHCMLAGGVGLVGHIEICDNVFVTGMTMVTRSITEPGSYSSGTAMQPAAE---WKKSAA............... 334
67 -10.6001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  14  219...RLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTN-------IEGNVTLGHRVKIGTGCVIKNSVITVVEDANLELLEGAHVGNFVEMKKARGH-LGDAEIGDNVNIGAGTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKEG---WRRPVKKK............. 456
68 -10.5001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFE  ali model follow..  20  225.........GVNDRVALATAESVMRRRINHKHMVNGVSFVNPEATYIDIDVEIASEVQIEANKGQTKIGAETVLTNGTYVVIGAGAVITNSMISVADGVIVSLGAQVHIGNFVEVKGSSGH-IGNCEVGSNVNFGYKTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIG................................. 438
69 -10.5004fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  17  222...RLSEVEGVNNRLQLSALERVFQTEQAEKLLLAGVMLLDPSRFDLRGELTHGRDITIDTN-------IEGHVILGDRVRIGTGCVLKNCVITVLEDARLELAEGAHVGNFVEIKKARGH-LGDAEIGAGVNIGAGTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVHIQG---WKRPVKKK............. 459
70 -10.5002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  16  219...DVMEVEGANNRLQLAALERYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVN-------IEGNVKLGDRVKIGTGCVLKNVVISVLEDSIVELAAETHVGNFVEIKKSTNH-VGDSEIGSNCNIGAGVIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELVITRVAQRHIQG---WQRPIKKK............. 456
71 -10.5001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFE  ali model follow..  15  228.........GVNDRVALATAESVMRRRINHK-VNGVSFVNPEATYIDIDVEIAPEVQITVLTNGTYVVDSTIGAGAVITNSMIEESSVADGVTVAHIRPNSSLGAQVHIGNFVEVKGSSGH-IGNCEVGSNVNFGYKTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIG................................. 441
72 -10.4002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxy  ali model follow..  18  210....................................................................................AHIIPEDNTRILESSKVRMG--ASLAAGTTIMPGASYVNFNAGTTGAC--SSSAIVGEGSDVGGGASIL--ISVGKACLLGANSVTGIPLGDNCIVDAG................................ 318
73 -10.4005b04_I mol:protein length:678 Probable translation initiation factor eIF-2B  ali model follow..  25  331...............................................................................TLIGAYTKVGDASVV----ANTIIGRNCTIGSNCSIDSAFLWEDVVIGDNCRIGKA---ILANSVKIGNNCSIEDGAIVAAGVVIGDNTIIEKNK......................................... 418
74 -10.4003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate  ali model follow..  17  131............................................................................NIGAFVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGI----GGVLEPLQ-------ANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSVPAGSVVVSGN-AVIVKKVDAKTRSKV............... 266
75 -10.4001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SU  ali model follow..  18  129............................................................................NIGAYVDEGTMVDTWATV---GSCAQIGKNVHLSGGVGI----GGVLEPLQ-------ANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSVPAGSVVVSGN-AVIVKKVDAKTRGKV............... 264

FFAS is supported by the NIH grant R01-GM087218-01
8 2 9 8 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Erlandsen H, Godzik A. HEPN: a common domain in bacterial drug resistance and human neurodegenerative proteins. Trends Biochem Sci. 2003 May;28(5):224-6. Review.