current user: public

anford Burnham Prebys Medical Discovery Institute

Query: 2w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
2 -36.6003gcw_E mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  98  2...................AMGTNECLDNNGGCSYVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK 83
5 -27.3003v65_B mol:protein length:386 Low-density lipoprotein receptor-related prot  ali model follow..  39  1....................TGEENCNVNNGGCAQKCQMIRGAVQCTCHTGYRLEDGRTCQDVNECAEEGYCSQGCTNSEGAFQCWCEAGYELRPDRRSCK 82
6 -27.2001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  26  69.AQVNMYKCGCIEGYTKEDTCVLDVCQYKNGECIVEYLSEIQSAGCSCAIGKVPNDEKKCTKTGETACQLKCNEVCKNVEGVYKCQCMEGFTFDKEKNVC. 177
8 -26.7001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  35  2.....................DIDECRISPDLCGRQCVNTPGDFECKCDEGYESGMMKNCMDIDECQRDPLRGGVCHNTEGSYRCECPPGHQLSPNISAC. 85
9 -26.3001z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  40  1....................KDVDECSLKPSICTAVCKNIPGDFECECPEGYRYNKSKSCEDIDECSE-NMCAQLCVNYPGGYTCYCKKGFKLAQDQKSCE 84
13 -21.2001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  15  1..................APLAQQTCANNRHQCSVECRDYATGFCCRCVANYT-GNGRQCVAEGSPQRKGRIFVGSSQVPVVFENTDLHSYVVMNHGRSY. 88
14 -20.8001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  22  43..................KYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACI 125
19 -17.8003v64_C mol:protein length:349 agrin  ali model follow..  35  296..............HPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACALEVLFQ.................................. 348
20 -17.6001fax_L mol:protein length:96 FACTOR XA  ali model follow..  23  3.....................DGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQASVVCSCARGYTLADNGKACI 82
21 -17.5003m0c_C mol:protein length:791 Low-density lipoprotein receptor  ali model follow..  84  295....MARDCRDWSDEPIKEC-GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK 390
22 -17.1003s94_A mol:protein length:619 Low-density lipoprotein receptor-related prot  ali model follow..  28  556................................................LMGLKATNVHRVIGSNPCAENGGCSHLCLYRPQGLRCACPIGFELISDMKTCI 609
24 -15.9001apq_A mol:protein length:53 COMPLEMENT PROTEASE C1R  ali model follow..  38  1...........................................................AVDLDECASRSKCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ 51
25 -15.8002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  20  1....................SDVNECLTIPEACEMKCINHYGGYLCLPRSAAVI------------NDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS... 68
26 -15.6003kl6_B mol:protein length:57 Coagulation Factor X light chain  ali model follow..  20  3.....................ARKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLDNGKACIPTGPYP----CGKQTLE....................... 56
27 -15.1002gd4_L mol:protein length:58 Coagulation factor X, Stuart factor, Stuart-P  ali model follow..  22  2......................RKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLDNGKACIPTGPYP.................................. 47
29 -14.7003soq_A mol:protein length:318 Low-density lipoprotein receptor-related prot  ali model follow..  35  259..............SQQRQPNATNPCGIDNGGCSHLCLMSPVFYQCACPTGVKLENGKTCKDGNS.................................... 312
30 -14.6004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  20  19LNTLGSFECQCLQGYTGPRCEDVNECISNPCQNDATCLDQIGEFQCICMPGY---EGVYCEINTDECASSPCLHRCVDKINEFLCQCPKGFS......... 110
31 -14.5003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  24  4.....................GGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQC. 82
32 -14.3004a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  31  580.......................HPCAQDNGGCSHICLVKGGTTRCSCPMHLVLQDELSCGGTK..................................... 622
33 -14.2003s2k_A mol:protein length:629 Low-density lipoprotein receptor-related prot  ali model follow..  33  578.......................HPCAQDNGGCSHICLVKGGTTRCSCPMHLVLQDELSCGE....................................... 618
34 -13.9004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  17  401VDLGDAYLCRCQAGFSGRHCDNVDDCASSPCANGGTCRDGVNDFSCTCPPGY---TGRNCSAPVSRCEHAPCHNTCHQRGHGYVCECARSYG----GPNCQ 497
35 -13.9003s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  27  577...............................................................HPCADNGGCSHICLVKGGTTRCSCPMHLVLLQDELSC. 615
37 -13.7004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  12  47LKGTMTYNGEGPIGFRGTLSSANNYTVENQWGGTSKTLTGTTTYNGEGPIGFK--SAAPWHSGGVWVLGTRGKQKTLSGTMTYNGEGPIGFR----GTLTS 201
40 -13.2004yzu_B mol:protein length:62 Coagulation factor IX  ali model follow..  27  2......................DVTCNIKNGRCEQFCKNSANKVVCSCTEGYRLENQKSCEPAVPF................................... 47
41 -13.0001kig_L mol:protein length:51 FACTOR XA  ali model follow..  24  1.........................CSLDNGGCDQFCREERSEVRCSCAHGYVLDDSKSCVSTERFP----CGKFTQG....................... 50
42 -12.9002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  14  4...............PKHVCVDTRDIPKN----AGCFRDDDGTEEWRCLLGYKKGEGNVENNNPTCDNNGGCDPTSTENSKKIICTCKEPTPNAYEGVFC. 95
45 -12.6002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  17  4...............PKHVCVDTRDIPKN----AGCFRDDDGTKEWRCLLGYKKGEGNVENNNPTCDNNGGCDPSCQNAESTIICTCKEPTP-YYEGVFCS 96
46 -12.5002ra0_L mol:protein length:51 Coagulation factor X  ali model follow..  24  2.........................CSLDNGDCDQFCHEEQNSVVCSCARGYTLDNGKACIPTGPY................................... 43
48 -12.1004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  21  178.....DGSPSCLPGWTGKYC-DQPICLSGCHEQNGYCSK---PDECNCRPGWQGPLCNECIP-HKGCRHGTC-------TIPWQCACDEGWG----GLFCD 257
49 -11.8001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  16  3...............EASNMSSAHKCIDTNVPENAACYRYDGTEEWRCLLGFK-EVGGKCVPASICAPEAECTM---DDKKEVECKCTKEGSPLFEGVFC. 93
50 -11.5001rfn_B mol:protein length:57 PROTEIN (COAGULATION FACTOR IX)  ali model follow..  28  2........................TCNIKNGRCEQFCKNSANKVVCSCTEGYRLENQKSCEPAVPF................................... 45
51 -11.4004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  21  21....GSFSCECPDGFTDPNCSSAGPCTPNPCHNGGTCEDTFIGYVCKCPRGF---NGIHCQHNINECEVEPCKNICTDLVANYSCECPGEFM----GRNCQ 132
52 -11.3002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  15  1..................TMSSEHTCIDTNVPDNAACYRYDGTEEWRCLLTFK-EEGGKCVPASNCAPEAECKM---TDSNKIVCKCTKEGSPLFEGVFCS 90
54 -10.8003f1s_B mol:protein length:283 Vitamin K-dependent protein Z  ali model follow..  32  3...............................................................NECERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQC. 41
56 -10.6002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  21  76.....PGDCRCQYGWQGLYC---DKCIPHPGCVHGICNE---PWQCLCETNWG-KDLNYCGTHQPCLNGGTCSN---TGPDKYQCSCPEGYS----GPNCE 162
58 -10.3004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  15  217.......ECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGPYGCSCATGWKGLQGPDCKLRCSCNNGEMCDRF---------CLCSPGWQGLQCEREG. 322
59 -10.2004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  17  146.....SYRVVCSDNYYGDSCSRLRDDHFGHYECQP-------DGSPSCLPGWT---GKYCDQ-GCHEQNGYCSK-------PDECNCRPGWQ----GPLCN 227
61 -9.7801xfe_A mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  73  28....MARDCRDWSDEPIKEC-GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCE........................................ 83
62 -9.5501yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  20  23....GSWSCFCPVGFNGTHCEDLDECALVPDICVPRCVNTQPGFHCPCPPRYR-TEKQVCEPENPCHKHAECIYLGHFSDPMYKCECQTGYA......... 138

FFAS is supported by the NIH grant R01-GM087218-01
9 5 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Dunbrack RL Jr, Dunker K, Godzik A. Protein structure prediction in biology and medicine. Pac Symp Biocomput. 2000;(12):93-4.