current user: public




Query: 2w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR, from PDB0516

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MKPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKLast
1 -45.0002w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR  ali model  100  1MKPMSDYDIPTTENLYFQGAMGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK 101
2 -36.6003gcw_E mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  98  2...................AMGTNECLDNNGGCSYVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK 83
3 -30.1003gis_X mol:protein length:121 Thrombomodulin  ali model follow..  25  20..NQTSYLCVCAEGFEPHRCQLFCNQ----TACPADC-DPNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALAGQIGTD. 117
4 -28.1001dx5_I mol:protein length:118 THROMBOMODULIN  ali model follow..  26  21...QTSYLCVCAEGFEPHRCQMFCNQ----TACPADC-DPNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALAQIGTDC. 118
5 -27.3003v65_B mol:protein length:386 Low-density lipoprotein receptor-related prot  ali model follow..  39  1....................TGEENCNVNNGGCAQKCQMIRGAVQCTCHTGYRLEDGRTCQDVNECAEEGYCSQGCTNSEGAFQCWCEAGYELRPDRRSCK 82
6 -27.2001z1y_A mol:protein length:186 ookinete surface protein Pvs25  ali model follow..  26  69.AQVNMYKCGCIEGYTKEDTCVLDVCQYKNGECIVEYLSEIQSAGCSCAIGKVPNDEKKCTKTGETACQLKCNEVCKNVEGVYKCQCMEGFTFDKEKNVC. 177
7 -27.0002w86_A mol:protein length:147 FIBRILLIN-1  ali model follow..  24  18KNSPGSFICECSSESTKTICIETIKGTCWQTVIDGRCECTLCQVDPICGKGYSRIKGTQCEDIDECEVFPGKNGLCVNTRGSFKCQCPSGMTLDATGRIC. 146
8 -26.7001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  35  2.....................DIDECRISPDLCGRQCVNTPGDFECKCDEGYESGMMKNCMDIDECQRDPLRGGVCHNTEGSYRCECPPGHQLSPNISAC. 85
9 -26.3001z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  40  1....................KDVDECSLKPSICTAVCKNIPGDFECECPEGYRYNKSKSCEDIDECSE-NMCAQLCVNYPGGYTCYCKKGFKLAQDQKSCE 84
10 -26.1001emn_A mol:protein length:82 FIBRILLIN  ali model follow..  32  1..................SAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYIL-AGNECVDTDECSVGNPGNGTCKNVIGGFECTCEEGFEPG-PMMTCE 82
11 -24.6001uzj_A mol:protein length:162 FIBRILLIN-1  ali model follow..  20  18VNTPGSYICDCPPDFTRVGCVDTRSGNC---YLDIRPRGDNGDTACSNEIGVGVSITVILEDIDECQELPGQGGKCINTFGSFQCRCPTGYYLNEDTRVCD 162
12 -24.2002bo2_A mol:protein length:143 EGF-LIKE MODULE CONTAINING MUCIN-LIKE HORMONE  ali model follow..  22  17....NATACRCNPGFPMETCDDINECATLSKVSFSDCWNTEGSYDCVCSPGYEPVSENTCQDVDECSSGQH-STVCFNTVGSYSCRCRPGWKPRHGIPNNQ 137
13 -21.2001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  15  1..................APLAQQTCANNRHQCSVECRDYATGFCCRCVANYT-GNGRQCVAEGSPQRKGRIFVGSSQVPVVFENTDLHSYVVMNHGRSY. 88
14 -20.8001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  22  43..................KYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACI 125
15 -20.6001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  19  19YEEAREVFEDSDKTNEFWNKKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACI 120
16 -20.6001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  19  2............KHVDGDQCLVLPLEHPCASLCCGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNCSDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCH 93
17 -18.4001dqb_A mol:protein length:83 THROMBOMODULIN  ali model follow..  22  1..................HMEPVDPCF--RANCEYQCQPNQTSYLCVCAEGFAPIPHEPHRCQMFCNQ-TACPADCDPN-TQASCECPEGYILD-DGFICT 79
18 -18.2001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  24  25FEEAREVFENTEKTNEFWKQVDGDQCEPNPCLNGGLCKDDINSYECWCQVGF---EGKNCEDATCNIKNGRCKQCKTGADSKVLCSCTTGYRLAPDQKSCK 125
19 -17.8003v64_C mol:protein length:349 agrin  ali model follow..  35  296..............HPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGFRKINSHACALEVLFQ.................................. 348
20 -17.6001fax_L mol:protein length:96 FACTOR XA  ali model follow..  23  3.....................DGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQASVVCSCARGYTLADNGKACI 82
21 -17.5003m0c_C mol:protein length:791 Low-density lipoprotein receptor  ali model follow..  84  295....MARDCRDWSDEPIKEC-GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK 390
22 -17.1003s94_A mol:protein length:619 Low-density lipoprotein receptor-related prot  ali model follow..  28  556................................................LMGLKATNVHRVIGSNPCAENGGCSHLCLYRPQGLRCACPIGFELISDMKTCI 609
23 -16.2001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  21  2....NAFLEELRPGSLERECKDGDQCASSPCQNGGSCKDQLQSYICFCLPAFE---GRNCEHKDDQLINGGCEQYCSDHTGTRSCRCHEGYSLLADGVSCT 128
24 -15.9001apq_A mol:protein length:53 COMPLEMENT PROTEASE C1R  ali model follow..  38  1...........................................................AVDLDECASRSKCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ 51
25 -15.8002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  20  1....................SDVNECLTIPEACEMKCINHYGGYLCLPRSAAVI------------NDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS... 68
26 -15.6003kl6_B mol:protein length:57 Coagulation Factor X light chain  ali model follow..  20  3.....................ARKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLDNGKACIPTGPYP----CGKQTLE....................... 56
27 -15.1002gd4_L mol:protein length:58 Coagulation factor X, Stuart factor, Stuart-P  ali model follow..  22  2......................RKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLDNGKACIPTGPYP.................................. 47
28 -14.9002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  18  22INTLGSFECQCLQGYTGPRCEDVNECVSNPCQNDATCLDQIGEFQCICMPGY---EGVHCEVNTDECASSPCLHRCLDKINEFQCECPTGFT......... 113
29 -14.7003soq_A mol:protein length:318 Low-density lipoprotein receptor-related prot  ali model follow..  35  259..............SQQRQPNATNPCGIDNGGCSHLCLMSPVFYQCACPTGVKLENGKTCKDGNS.................................... 312
30 -14.6004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  20  19LNTLGSFECQCLQGYTGPRCEDVNECISNPCQNDATCLDQIGEFQCICMPGY---EGVYCEINTDECASSPCLHRCVDKINEFLCQCPKGFS......... 110
31 -14.5003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  24  4.....................GGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQC. 82
32 -14.3004a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  31  580.......................HPCAQDNGGCSHICLVKGGTTRCSCPMHLVLQDELSCGGTK..................................... 622
33 -14.2003s2k_A mol:protein length:629 Low-density lipoprotein receptor-related prot  ali model follow..  33  578.......................HPCAQDNGGCSHICLVKGGTTRCSCPMHLVLQDELSCGE....................................... 618
34 -13.9004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  17  401VDLGDAYLCRCQAGFSGRHCDNVDDCASSPCANGGTCRDGVNDFSCTCPPGY---TGRNCSAPVSRCEHAPCHNTCHQRGHGYVCECARSYG----GPNCQ 497
35 -13.9003s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  27  577...............................................................HPCADNGGCSHICLVKGGTTRCSCPMHLVLLQDELSC. 615
36 -13.8004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  12  58LTGTMTYVGEGPIGFRATLTQSNTYAVENQWGGSSATLAGTMTYAGEGPIGFK---SQQADSSAPWHNGGVWSGKTLNGNMTYAGEGPIGFK----GNSVA 211
37 -13.7004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  12  47LKGTMTYNGEGPIGFRGTLSSANNYTVENQWGGTSKTLTGTTTYNGEGPIGFK--SAAPWHSGGVWVLGTRGKQKTLSGTMTYNGEGPIGFR----GTLTS 201
38 -13.6001cej_A mol:protein length:96 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  13  1.....................NISQHQCVKKQCPQNSGHLDEREECKCLLNYK-QEGDKCVENPNCDADAKCTEESGSNGKKITCECTKPDSYPLDGIFCS 93
39 -13.4004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  21  217.....PGDCRCQYGWQGLYC---DKCIPHPGCVHGICNE---PWQCLCETNWG-KDLNYCGTHQPCLNGGTCSN---TGPDKYQCSCPEGYS----GPNCE 303
40 -13.2004yzu_B mol:protein length:62 Coagulation factor IX  ali model follow..  27  2......................DVTCNIKNGRCEQFCKNSANKVVCSCTEGYRLENQKSCEPAVPF................................... 47
41 -13.0001kig_L mol:protein length:51 FACTOR XA  ali model follow..  24  1.........................CSLDNGGCDQFCREERSEVRCSCAHGYVLDDSKSCVSTERFP----CGKFTQG....................... 50
42 -12.9002mgp_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  14  4...............PKHVCVDTRDIPKN----AGCFRDDDGTEEWRCLLGYKKGEGNVENNNPTCDNNGGCDPTSTENSKKIICTCKEPTPNAYEGVFC. 95
43 -12.9005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  22  19LPFEASYICHCPPSFHGPTCRDVNECGQKPGLCRHTCHNEVGSYRCVCRATHT---GPNCESPSPCQNGGTCRPT---GDVTHECACLPGFT......... 113
44 -12.7001ob1_C mol:protein length:99 MAJOR MEROZOITE SURFACE PROTEIN  ali model follow..  13  1.....................NISQHQCVKKQCPQNSGHLDEREECKCLLNYK-QEGDKCVENPNCDADAKCTEESGSNGKKITCECTKPDSYPLDGIFCS 93
45 -12.6002mgr_A mol:protein length:99 Merozoite surface protein 1  ali model follow..  17  4...............PKHVCVDTRDIPKN----AGCFRDDDGTKEWRCLLGYKKGEGNVENNNPTCDNNGGCDPSCQNAESTIICTCKEPTP-YYEGVFCS 96
46 -12.5002ra0_L mol:protein length:51 Coagulation factor X  ali model follow..  24  2.........................CSLDNGDCDQFCHEEQNSVVCSCARGYTLDNGKACIPTGPY................................... 43
47 -12.4005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  20  16LPFEASYICHCPPSFHGPTCRDVNECGEKPGLCRHTCHNEVGSYRCVCRATHTCERPYVPCSPSPCQNGGTCRPT---GDVTHECACLPGFT......... 110
48 -12.1004xlw_B mol:protein length:261 Delta-like protein  ali model follow..  21  178.....DGSPSCLPGWTGKYC-DQPICLSGCHEQNGYCSK---PDECNCRPGWQGPLCNECIP-HKGCRHGTC-------TIPWQCACDEGWG----GLFCD 257
49 -11.8001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  16  3...............EASNMSSAHKCIDTNVPENAACYRYDGTEEWRCLLGFK-EVGGKCVPASICAPEAECTM---DDKKEVECKCTKEGSPLFEGVFC. 93
50 -11.5001rfn_B mol:protein length:57 PROTEIN (COAGULATION FACTOR IX)  ali model follow..  28  2........................TCNIKNGRCEQFCKNSANKVVCSCTEGYRLENQKSCEPAVPF................................... 45
51 -11.4004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  21  21....GSFSCECPDGFTDPNCSSAGPCTPNPCHNGGTCEDTFIGYVCKCPRGF---NGIHCQHNINECEVEPCKNICTDLVANYSCECPGEFM----GRNCQ 132
52 -11.3002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  15  1..................TMSSEHTCIDTNVPDNAACYRYDGTEEWRCLLTFK-EEGGKCVPASNCAPEAECKM---TDSNKIVCKCTKEGSPLFEGVFCS 90
53 -11.2001b9w_A mol:protein length:95 PROTEIN (MEROZOITE SURFACE PROTEIN 1)  ali model follow..  17  3.....................SEHRCIDTNVPENAACYRYDGTEEWRCLLYFK-EDAGKCVPAPNCAPEAECKM---NDKNEIVCKCTKEGSPLFEGVFCS 89
54 -10.8003f1s_B mol:protein length:283 Vitamin K-dependent protein Z  ali model follow..  32  3...............................................................NECERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQC. 41
55 -10.8004bxs_A mol:protein length:423 FACTOR X-LIKE PROTEASE  ali model follow..  21  45......................VDGDQCSSNPCHYICKDGIGSYTCTCLSGYEGKNCERVLYKSCRVDNGNCWHFCKHVQNDIQCSCAEGYLLGEDGHSCV 125
56 -10.6002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  21  76.....PGDCRCQYGWQGLYC---DKCIPHPGCVHGICNE---PWQCLCETNWG-KDLNYCGTHQPCLNGGTCSN---TGPDKYQCSCPEGYS----GPNCE 162
57 -10.4001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  18  2....NSFLEEVKQGNLERECLEEACSLEEAREVFEDAEQTDEFWSKY-------------KDGDQCEGHPCLNQHCKDGIGDYTCTCAEGF----EGKNCE 82
58 -10.3004k0v_A mol:protein length:529 TEK tyrosine kinase variant  ali model follow..  15  217.......ECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGPYGCSCATGWKGLQGPDCKLRCSCNNGEMCDRF---------CLCSPGWQGLQCEREG. 322
59 -10.2004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  17  146.....SYRVVCSDNYYGDSCSRLRDDHFGHYECQP-------DGSPSCLPGWT---GKYCDQ-GCHEQNGYCSK-------PDECNCRPGWQ----GPLCN 227
60 -10.0004ux8_A mol:protein length:607 PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPT  ali model follow..  14  512.......RCEWRQGDGKGITRNFSTCSPSTKTCDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFCEPE---DIQDPLCD 603
61 -9.7801xfe_A mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  73  28....MARDCRDWSDEPIKEC-GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCE........................................ 83
62 -9.5501yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  20  23....GSWSCFCPVGFNGTHCEDLDECALVPDICVPRCVNTQPGFHCPCPPRYR-TEKQVCEPENPCHKHAECIYLGHFSDPMYKCECQTGYA......... 138
63 -9.5301tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  21  1.....SYQVICRDEKTQMIY-QQHQSWLRP------VLRSNRVEYCWCNSGRA-VPVKSCSE-PRCFNGGTCQQ--ALYFSDFVCQCPEGFA----GKSCE 85

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.