current user: public

Query: 2w2m_E mol:protein length:107 LOW-DENSITY LIPOPROTEIN RECEPTOR, from PDB0312

Results of FFAS03 search in PDB0312
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
2 -36.7003gcw_E mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  98  1..................GAMGTNECLDNNGGCSYVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK 83
8 -28.1001lmj_A mol:protein length:86 fibrillin 1  ali model follow..  35  1....................TDIDECRISPDLCGRQCVNTPGDFECKCDEGYESGMMKNCMDIDECQRDPLLGGVCHNTEGSYRCECPPGHQLSPNISAC. 85
11 -26.9001z6c_A mol:protein length:87 Vitamin K-dependent protein S  ali model follow..  40  1....................KDVDECSLKPSICTAVCKNIPGDFECECPEGYRYNLKKSCEDIDECSE-NMCAQLCVNYPGGYTCYCDKGFKLAQDQKSCE 84
13 -22.6001gl4_A mol:protein length:285 NIDOGEN-1  ali model follow..  16  3....................LAQQTCANNRHQCSAECRDYATGFCCRCVANYT-GNGRQCVAEGSPQRKGRIFVGSSQVPVVFENTDLHSYVVMNHGRSYT 89
14 -22.0001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  20  1...ANSFLEEMKKGHLERECMDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNGKACI 125
18 -18.7001dqb_A mol:protein length:83 THROMBOMODULIN  ali model follow..  24  1..................HMEPVDPCF--RANCEYQCQPNQTSYLCVCAEGFAPIEPHRCQMFCNQ---TACPADC-DPNTQASCECPEGYILD-DGFICT 79
22 -17.7001n1i_A mol:protein length:105 Merozoite surface protein-1  ali model follow..  16  3...............EASNMSSAHKCIDTNVPENAACYRYDGTEEWRCLLGFKEVGGKCVPASITCEENNG-EAECTMDKKEVECKCTKEGSPLFEGVFCS 94
23 -17.5002kl7_A mol:protein length:71 Fibulin-4  ali model follow..  19  1....................SDVNECLTIPEACEMKCINHYGGYLCLPRSAAVINDLHG------------EGPPPPVPPAQHPNPCPPGYEPDDQDS... 68
25 -17.2001apq_A mol:protein length:53 COMPLEMENT PROTEASE C1R  ali model follow..  38  1...........................................................AVDLDECASRSKCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ 51
26 -16.5003kl6_B mol:protein length:57 Coagulation Factor X light chain  ali model follow..  21  2....................RARKLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNKACIPTGPYP.................................. 49
27 -15.7002gd4_L mol:protein length:58 Coagulation factor X, Stuart factor, Stuart-P  ali model follow..  20  3.......................KLCSLDNGDCDQFCHEEQNSVVCSCARGYTLADNKACIPTGPYPGKQTLERRK......................... 57
28 -15.4003h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  23  3....................KGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQC. 82
30 -15.0002npr_A mol:protein length:90 Merozoite surface protein 1  ali model follow..  15  1..................TMSSEHTCIDTNVPDNAACYRYDGTEEWRCLLTFK-EEGGKCVPASNCAPEAECKM---TDSNKIVCKCTKEGSEPLEGVFCS 90
34 -14.1001kig_L mol:protein length:51 FACTOR XA  ali model follow..  22  1.........................CSLDNGGCDQFCREERSEVRCSCAHGYVLGDDKSCVSTERFPCGKFTQG........................... 50
35 -14.0002ra0_L mol:protein length:51 Coagulation factor X  ali model follow..  20  2.........................CSLDNGDCDQFCHEEQNSVVCSCARGYTLADNKACIPTGPYPCGKQTLE........................... 51
36 -13.9002wph_E mol:protein length:59 COAGULATION FACTOR IXA LIGHT CHAIN  ali model follow..  22  2.........................CNIKNGRCEQFCKNSANKVVCSCTEGYRLAENKSCEPAVPFP----CGRVSVSQTSKLT................. 58
37 -13.8003kcg_L mol:protein length:59 Coagulation factor IXa light chain  ali model follow..  23  3.......................VTCNIKNGRCEQFCKNSANKVVCSCTEGYRLAENKSCEPAVPFP----CGRVSVSQTS.................... 58
38 -13.0002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  21  76.....PGDCRCQYGWQGLYC---DKCIPHPGCVHGICNE---PWQCLCETNWG-KDLNYCGTHQPCLNGGTCSNT---GPDKYQCSCPEGYS----GPNCE 162
39 -12.9003s3z_A mol:protein length:223 Tandem Cyanovirin-N Dimer CVN2L10  ali model follow..  13  26.......TCERTNGGYNTSSIDLNSVIENVDGCRNTQLAGSSELAAECKTRAQ-QFVSTKINLDDHIANIDGTLKYEGGSGGGGSGGLGKFS-----QTCY 125
40 -12.7003s94_A mol:protein length:619 Low-density lipoprotein receptor-related prot  ali model follow..  32  572...............................................................PCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTC. 608
41 -12.7001rfn_B mol:protein length:57 PROTEIN (COAGULATION FACTOR IX)  ali model follow..  24  3.........................CNIKNGRCEQFCKNSANKVVCSCTEGYRLAENKSCEPAVPFP----CGRVSVSQTS.................... 56
42 -12.2001xfe_A mol:protein length:83 Low-density lipoprotein receptor  ali model follow..  69  20..ITLDKVCNCRDWSDEPIKEGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCE........................................ 83
45 -11.4002gy5_A mol:protein length:423 Angiopoietin-1 receptor  ali model follow..  16  215.....TGECICPPGFMGRTCEKACELHTFGRTCKERCSGLPDPYGCSCATGWKGLQGPDCKLRCSCNNGEMCDR-------FQGCLCSPGWQ----GLQCE 319
47 -11.1001yo8_A mol:protein length:634 thrombospondin-2  ali model follow..  21  20.FPDGSWSCFCPVGFLGNHCEDLDECALVPDICFPRCVNTQPGFHCPCPPRYR-TEKQVCEPENPCKDKTHCIYLGHFSDPMYKCECQTGYA......... 138
48 -11.0001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  16  24LEEAREVFEDAEQTDEFWSKKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFE................................................ 77
49 -10.9003soq_A mol:protein length:318 Low-density lipoprotein receptor-related prot  ali model follow..  36  271.................................................................GIDNGGCSHLCLMSPPFYQCACPTGVKLLENGKTCK 308
50 -10.6003s2k_A mol:protein length:629 Low-density lipoprotein receptor-related prot  ali model follow..  28  582..................................................................QDNGGCSHICLVKGGTTRCSCPMHLVLLQDELSCG 617
51 -10.1004a0p_A mol:protein length:628 LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATED PROT  ali model follow..  28  584..................................................................QDNGGCSHICLKGDGTTRCSCPMHLVLLQDELSCG 619
52 -9.9603nkm_A mol:protein length:831 Ectonucleotide pyrophosphatase/phosphodiester  ali model follow..  22  9..................TVLSDSPWTNTSGSCKGRCFELVGPPDCRC--------DNLCKSYSSC-----CDELCLKTARGWECRCGEVRN---EENACH 83
53 -9.8803s8v_A mol:protein length:623 Low-density lipoprotein receptor-related prot  ali model follow..  29  581..................................................................QDNGGCSHICLKGDGTTRCSCPMHLVLLQDELSC. 615
54 -9.8603f1s_B mol:protein length:283 Vitamin K-dependent protein Z  ali model follow..  32  3...............................................................NECERTDGCQHFCLPGQESYTCSCAQGYRLGEDHKQC. 41
55 -9.7702xrg_A mol:protein length:862 ECTONUCLEOTIDE PYROPHOSPHATASE/PHOSPHODIESTER  ali model follow..  23  47.....................SDSPWTNTSGSCKGRCFELVGPPDCRC--------DNLCKSYSSC-----CDELCLKTARGWECRCGEVRN---EENACH 118
57 -9.3902dtg_E mol:protein length:897 Insulin receptor  ali model follow..  19  208........CECLGNCSQPD--DPTKCVA--------CRNFYLDGRCTCPPPYYHFQDWRCVNFSFCQDHHKCKNSRRQGCHQYKCECPSGYTMNSSNLLCT 302
58 -9.2702ddu_A mol:protein length:387 reelin  ali model follow..  11  196.................SYCSGHGDCISG---------------VCFCDLGYT---AAQGTCVSNTPNHSEMFDRFEGKLSPLWYKITGGQV----GTGCG 257
59 -9.1203loh_E mol:protein length:917 Insulin receptor  ali model follow..  19  208........CECLGNCSQPD--DPTKCVA--------CRNFYLDGRCTCPPPYYHFQDWRCVNFSFCQDHHKCKNSRRQGCHQYKCECPSGYTMNSSNLLCT 302
60 -9.1102i9a_A mol:protein length:145 Urokinase-type plasminogen activator  ali model follow..  12  29....NIHWCNCPKKFGGQHCEDKSKTCYEGNGHFYKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHYCRNPDNRRRPWCYVQVGLKPLVQECM 129

FFAS is supported by the NIH grant R01-GM087218-01
6 8 7 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.